DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17477 and CG31219

DIOPT Version :9

Sequence 1:NP_650598.1 Gene:CG17477 / 42067 FlyBaseID:FBgn0038479 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001097837.1 Gene:CG31219 / 42344 FlyBaseID:FBgn0051219 Length:345 Species:Drosophila melanogaster


Alignment Length:262 Identity:64/262 - (24%)
Similarity:103/262 - (39%) Gaps:44/262 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 IVGGQNAAEGDAPYQVSLQTLLGSHL-----CGGAIISDRWIITAGHCVKGYPTSRLQVATGTIR 86
            :|||..|.....|:...|..|..:.|     |.|::|::|:::|:.|||.|.|.   .::..::|
  Fly    89 MVGGSEARPNGYPWMAMLLYLNTTTLEILPFCAGSLINNRYVLTSAHCVNGIPR---DLSLKSVR 150

  Fly    87 YAEPGAVYYP----------------------DAIYLHCNYDSPKYQN---DIGLLHLNESITFN 126
            ..|....|.|                      :.|.:|..:.|...:|   ||.||.|...:.:.
  Fly   151 LGEHDITYDPAYNPDCRDQDNQCALPNLEIKLEKIIVHGLFSSISNRNIEYDIALLRLKMPVRYR 215

  Fly   127 ALTQAVELPTSPFPRGASELVFTGWGSQSAAGSLPSQLQRVQQQHLNSPACESMMSAYEDLELGP 191
            .....:.:|...| ...|:|...||| ::..|.....|.....:..:...| ::...|.||... 
  Fly   216 TGIMPICIPKHGF-FAKSKLEIAGWG-KTNEGQFSQVLMHGFIRERSIAVC-ALRFPYLDLNQS- 276

  Fly   192 CHICAYRQANIGACHGDSGGPLV-----HQGTLVGILNF-FVPCAQ-GVPDIFMNIMYYRDWMRQ 249
            ..|||.....:..|.|||||||:     ....|.||..: ...|.| |:|.|:.....:..|::.
  Fly   277 LQICAGGYDGVDTCQGDSGGPLMVTMDNSSVYLAGITTYGSKNCGQIGIPGIYTRTSAFLPWIKA 341

  Fly   250 TM 251
            .:
  Fly   342 VL 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17477NP_650598.1 Tryp_SPc 27..250 CDD:238113 64/259 (25%)
Tryp_SPc 27..246 CDD:214473 63/255 (25%)
CG31219NP_001097837.1 Tryp_SPc 88..339 CDD:214473 63/256 (25%)
Tryp_SPc 90..342 CDD:238113 64/258 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.