DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17477 and modSP

DIOPT Version :9

Sequence 1:NP_650598.1 Gene:CG17477 / 42067 FlyBaseID:FBgn0038479 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_536776.2 Gene:modSP / 42032 FlyBaseID:FBgn0051217 Length:628 Species:Drosophila melanogaster


Alignment Length:279 Identity:63/279 - (22%)
Similarity:104/279 - (37%) Gaps:59/279 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 CDLLA--LEHFIVGGQNAAEGDAPYQVSLQTLLGS---HL-CGGAIISDRWIITAGHCVKGYPTS 76
            |..||  ::.|..||........|:.|.|......   |. |||::::...:|||.|||....| 
  Fly   358 CGQLATPIKQFSSGGYTINNTVVPWHVGLYVWHNEKDYHFQCGGSLLTPDLVITAAHCVYDEGT- 421

  Fly    77 RLQVATGTIRYAEPGAVYY-------PD-------AIYLHCNYD--SPKYQNDIGLLHLNESITF 125
            ||..:..|.|..  .|.:|       |:       .|.:...|.  :..|..|:.||.|:|....
  Fly   422 RLPYSYDTFRVI--AAKFYRNYGETTPEEKRRDVRLIEIAPGYKGRTENYYQDLALLTLDEPFEL 484

  Fly   126 NALTQAVELPTSPFPRGAS-----ELVFTGWGSQSAAGSLPSQLQRVQQQHLNSPACESMMSAYE 185
            :.:.:.:.:..:.|....|     :..|.||..::     ..:||.|.....::..|...:   .
  Fly   485 SHVIRPICVTFASFAEKESVTDDVQGKFAGWNIEN-----KHELQFVPAVSKSNSVCRRNL---R 541

  Fly   186 DLELGPCHICAYRQANIGACHGDSGGPLVHQ-------------GTLVGILNFFVP----CAQGV 233
            |::..  ..|.:.|....||.|||||....:             ..|.|::: ..|    ||..:
  Fly   542 DIQAD--KFCIFTQGKSLACQGDSGGGFTSELPTNAFSTWNTARHFLFGVIS-NAPNADQCAHSL 603

  Fly   234 PDIFMNIMYYRDWMRQTMS 252
             .:..||.::.|.:...|:
  Fly   604 -TVMTNIQHFEDMILNAMN 621

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17477NP_650598.1 Tryp_SPc 27..250 CDD:238113 58/264 (22%)
Tryp_SPc 27..246 CDD:214473 57/260 (22%)
modSPNP_536776.2 LDLa 27..58 CDD:197566
LDLa 70..101 CDD:197566
LDLa 123..157 CDD:197566
LDLa 167..199 CDD:238060
CCP <251..284 CDD:153056
Sushi 309..354 CDD:278512
Tryp_SPc 371..616 CDD:214473 58/259 (22%)
Tryp_SPc 371..591 CDD:304450 52/232 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.