DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17477 and CG8870

DIOPT Version :9

Sequence 1:NP_650598.1 Gene:CG17477 / 42067 FlyBaseID:FBgn0038479 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_731802.1 Gene:CG8870 / 41645 FlyBaseID:FBgn0038144 Length:356 Species:Drosophila melanogaster


Alignment Length:235 Identity:59/235 - (25%)
Similarity:93/235 - (39%) Gaps:46/235 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 CGGAIISDRWIITAGHCVKGYPTSRLQVATGTIRYAEPGAVYYPD-----------AIYLHCNYD 106
            |||::|::.:::||.|||: ||......|..|:|..|......||           .:|:....|
  Fly   117 CGGSLINNWYVLTAAHCVE-YPFMDYPYALKTVRLGEHNTSTNPDRAIVNGRRQYAPLYMEIEVD 180

  Fly   107 ----------SPKYQNDIGLLHLNESITFNALTQAVELPTSPFPRGASELVF--TGWGSQSAAGS 159
                      ..:..|||.|:.|...:.:....|.:.||.:. ...|.:..|  :|| .....|.
  Fly   181 QIITHEQFNRGRRLINDIALVRLKFPVRYTRAIQPICLPRAQ-KLAAHKRKFQASGW-PDMGQGI 243

  Fly   160 LPSQLQR--VQQQHLNSPACESMMSAYEDLELGPCHICAYRQANIGACHGDSGGPLVH-----QG 217
            ....|.|  :.::|  ...|:|..    |..|| ..|||..........|||||||:.     :.
  Fly   244 ASEVLLRSFIAERH--PDVCKSNY----DFNLG-SQICAGGLDGNDTSPGDSGGPLMETVIRGKV 301

  Fly   218 TL---VGILNF-FVPCAQGV--PDIFMNIMYYRDWMRQTM 251
            ||   .||::: ..||....  |..:....|:.:|::..:
  Fly   302 TLTYAAGIISYGQKPCVLKTCKPAFYTKTSYFFEWIKSKL 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17477NP_650598.1 Tryp_SPc 27..250 CDD:238113 59/232 (25%)
Tryp_SPc 27..246 CDD:214473 58/228 (25%)
CG8870NP_731802.1 Tryp_SPc 93..340 CDD:238113 59/232 (25%)
Tryp_SPc 93..337 CDD:214473 58/229 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.