DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17477 and snk

DIOPT Version :9

Sequence 1:NP_650598.1 Gene:CG17477 / 42067 FlyBaseID:FBgn0038479 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001097766.1 Gene:snk / 41607 FlyBaseID:FBgn0003450 Length:435 Species:Drosophila melanogaster


Alignment Length:249 Identity:68/249 - (27%)
Similarity:98/249 - (39%) Gaps:31/249 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 IVGGQNAAEGDAPYQVSLQTLLGSHL--------CGGAIISDRWIITAGHCVKGYPTSRLQVATG 83
            ||||.....|..|:..:|....||..        ||||::|:.:::||.||..........|..|
  Fly   186 IVGGTPTRHGLFPHMAALGWTQGSGSKDQDIKWGCGGALVSELYVLTAAHCATSGSKPPDMVRLG 250

  Fly    84 TIRYAEPGAVYYPD---AIYLHCNYDSPKYQNDIGLLHLNESITFNALTQAV---ELPTSPFPRG 142
            ..:..|..|.....   .|.||..|.|..|.:||.||.|...:.|:...:..   :||....|  
  Fly   251 ARQLNETSATQQDIKILIIVLHPKYRSSAYYHDIALLKLTRRVKFSEQVRPACLWQLPELQIP-- 313

  Fly   143 ASELVFTGWGSQSAAGSLPSQLQRVQQQHLNSPACESMMSAYEDLELG--PCHICA-YRQANIGA 204
              .:|..|||.....|:..:.|::|....:....|:.:......|..|  ....|| |.......
  Fly   314 --TVVAAGWGRTEFLGAKSNALRQVDLDVVPQMTCKQIYRKERRLPRGIIEGQFCAGYLPGGRDT 376

  Fly   205 CHGDSGGPLVHQ--------GTLVGILNFFVPC-AQGVPDIFMNIMYYRDWMRQ 249
            |.|||||| :|.        ..:|||.:|...| |...|.::..:..|.||:.:
  Fly   377 CQGDSGGP-IHALLPEYNCVAFVVGITSFGKFCAAPNAPGVYTRLYSYLDWIEK 429

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17477NP_650598.1 Tryp_SPc 27..250 CDD:238113 68/249 (27%)
Tryp_SPc 27..246 CDD:214473 66/244 (27%)
snkNP_001097766.1 CLIP 93..139 CDD:197829
Tryp_SPc 186..430 CDD:238113 68/249 (27%)
Tryp_SPc 186..427 CDD:214473 67/245 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.