DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17477 and CG3916

DIOPT Version :9

Sequence 1:NP_650598.1 Gene:CG17477 / 42067 FlyBaseID:FBgn0038479 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_650167.1 Gene:CG3916 / 41484 FlyBaseID:FBgn0038003 Length:267 Species:Drosophila melanogaster


Alignment Length:284 Identity:79/284 - (27%)
Similarity:124/284 - (43%) Gaps:64/284 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LVFSSLYCDLLALEHFIV--------------GGQNAAEGDAPYQVSLQTL---LGSHLCGGAII 58
            :|...|:|.||.|...:.              |||...| ..|:|||||..   ...|.|||:|:
  Fly     1 MVVLQLFCMLLILRQGLADVVTSTTESPTRINGGQRVNE-TVPFQVSLQMQRRGRWQHFCGGSIV 64

  Fly    59 SDRWIITAGHCVKGYPTSRLQVATGTIRYAEPGAVYYPDAIYLHCNYD-SPKYQNDIGLLHLNES 122
            |.:.::||.||::......:.|..||:.:...|..:.....::|..|. :|:..|||.|:.:   
  Fly    65 SGQHVLTAAHCMEKMKVEDVSVVVGTLNWKAGGLRHRLVTKHVHPQYSMNPRIINDIALVKV--- 126

  Fly   123 ITFNALTQAVELPTSPFPR----------GASELV-------FTGWGSQS---AAGSLPSQLQRV 167
                         |.||..          |.|:.:       .|||||.|   ::.:||.|||.:
  Fly   127 -------------TPPFRLERSDISTILIGGSDRIGEKVPVRLTGWGSTSPSTSSATLPDQLQAL 178

  Fly   168 QQQHLNSPACESMMSAYEDLELGPCHICAYRQANIGACHGDSGGPLVHQGT---LVGILNF-FVP 228
            ..:.:::..|..     :...:....|||......|||.|||||||:..|.   ||||::: ...
  Fly   179 NYRTISNEDCNQ-----KGFRVTRNEICALAVQGQGACVGDSGGPLIRPGKQPHLVGIVSYGSST 238

  Fly   229 CAQGVPDIFMNIMYYRDWMRQTMS 252
            ||||.||::..:..:..::.|.::
  Fly   239 CAQGRPDVYTRVSSFLPYISQVIN 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17477NP_650598.1 Tryp_SPc 27..250 CDD:238113 72/264 (27%)
Tryp_SPc 27..246 CDD:214473 72/260 (28%)
CG3916NP_650167.1 Tryp_SPc 30..257 CDD:214473 72/248 (29%)
Tryp_SPc 31..260 CDD:238113 72/250 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449465
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.