DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17477 and CG17404

DIOPT Version :9

Sequence 1:NP_650598.1 Gene:CG17477 / 42067 FlyBaseID:FBgn0038479 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_650165.2 Gene:CG17404 / 41482 FlyBaseID:FBgn0038001 Length:275 Species:Drosophila melanogaster


Alignment Length:254 Identity:85/254 - (33%)
Similarity:122/254 - (48%) Gaps:37/254 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 HFIVGGQNAAEGD-APYQVSLQ--TLLGS-HLCGGAIISDRWIITAGHCVKGYPTSRLQVATGTI 85
            |.||||.:...|: .|||||||  |..|. |.|||:||:...|:||.||.:|...||:.|..|..
  Fly    33 HRIVGGADIPPGEHVPYQVSLQYRTRGGQMHFCGGSIIAPNRILTAAHCCQGLNASRMSVVAGIR 97

  Fly    86 RYAEPGAVYYPDAIYLHCNYDSPKYQ----NDIGLLHLNESITFNALT-QAVELPT--SPFPRGA 143
            ...|.|:.....:..:|     ||||    :|:.:|.:...:..|..| .|:|..:  ..|..|.
  Fly    98 GLNEKGSRSQVLSYSIH-----PKYQELVTSDLAVLSIKPPLKLNNSTISAIEYRSQGKDFVGGG 157

  Fly   144 SELVFTGWGSQSAAG-------SLPSQLQRVQQQHLNSPACESM-MSAYEDLELGPCHICAYRQA 200
            ..:..||||.:....       :.|:.|||:....:::..|.:. |.:..|.|     ||| |..
  Fly   158 VPVTLTGWGLRLPVPFPFLDNVNYPNVLQRMSYHTISNSECRNAGMESVTDTE-----ICA-RGP 216

  Fly   201 NIGACHGDSGGPLVHQG----TLVGILNF-FVPCAQGV-PDIFMNIMYYRDWM-RQTMS 252
            ..|||.||||||||.:.    ..|||::: .|.|...: ||::..:..:.||: .||.|
  Fly   217 FRGACSGDSGGPLVMESKNGLQQVGIVSYGLVVCGLYISPDVYTRVSTFSDWIGNQTKS 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17477NP_650598.1 Tryp_SPc 27..250 CDD:238113 81/248 (33%)
Tryp_SPc 27..246 CDD:214473 79/243 (33%)
CG17404NP_650165.2 Tryp_SPc 34..269 CDD:214473 80/245 (33%)
Tryp_SPc 35..269 CDD:238113 80/244 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449475
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.