DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17477 and Tmprss11c

DIOPT Version :9

Sequence 1:NP_650598.1 Gene:CG17477 / 42067 FlyBaseID:FBgn0038479 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001003979.1 Gene:Tmprss11c / 408213 RGDID:1302967 Length:418 Species:Rattus norvegicus


Alignment Length:233 Identity:79/233 - (33%)
Similarity:128/233 - (54%) Gaps:15/233 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 HFIVGGQNAAEGDAPYQVSLQTLLGSHLCGGAIISDRWIITAGHC-VKGYPTSRLQVATGTIRYA 88
            |.:.|||:|.||:.|:|.|||. ...|.||..:||:.|:|||.|| |:.......:|:.|.: .:
  Rat   185 HKVAGGQDAEEGEWPWQASLQQ-NNVHRCGATLISNSWLITAAHCFVRSANPKDWKVSFGFL-LS 247

  Fly    89 EPGAVYYPDAIYLHCNYDSPKYQNDIGLLHLNESITFNALTQAVELP--TSPFPRGASELVFTGW 151
            :|.|.....:|.:|.||..|.:.|||.::.|:..:.:....:...||  |..||.. |::|.|||
  Rat   248 KPQAQRAVKSIVIHENYSYPAHNNDIAVVRLSSPVLYENNIRRACLPEATQKFPPN-SDVVVTGW 311

  Fly   152 GSQSAAGSLPSQLQRVQQQHLNSPACESMMSAYEDLELGPCHICA-YRQANIGACHGDSGGPLVH 215
            |:..:.|..|:.||:.:.:.:::..|.| ..||..: :.|..:|| :.:..:.||.||||||||.
  Rat   312 GTLKSDGDSPNILQKGRVKIIDNKTCNS-GKAYGGV-ITPGMLCAGFLEGRVDACQGDSGGPLVS 374

  Fly   216 QGT-----LVGILNFFVPCA-QGVPDIFMNIMYYRDWM 247
            :.:     |.||:::...|| ...|.::..:.:||||:
  Rat   375 EDSKGIWFLAGIVSWGDECALPNKPGVYTRVTHYRDWI 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17477NP_650598.1 Tryp_SPc 27..250 CDD:238113 78/231 (34%)
Tryp_SPc 27..246 CDD:214473 76/228 (33%)
Tmprss11cNP_001003979.1 SEA 62..157 CDD:279699
Tryp_SPc 186..412 CDD:214473 77/230 (33%)
Tryp_SPc 187..415 CDD:238113 78/231 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.