DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17477 and Tryx5

DIOPT Version :9

Sequence 1:NP_650598.1 Gene:CG17477 / 42067 FlyBaseID:FBgn0038479 Length:267 Species:Drosophila melanogaster
Sequence 2:XP_006236430.1 Gene:Tryx5 / 408205 RGDID:1302947 Length:251 Species:Rattus norvegicus


Alignment Length:264 Identity:55/264 - (20%)
Similarity:95/264 - (35%) Gaps:56/264 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 LLAL------EHFIVGGQNAAE-----GDAPYQVSLQTLLGSHLCGGAIISDRWIITAGHCVKGY 73
            ||:|      |..:.|.|::.|     .:.||...|::  ....|.|.:|...|::||.||  ..
  Rat     9 LLSLAVASYPEVVLKGDQDSDEYLPENFNVPYMAYLKS--SPEPCVGTLIDPLWVLTAAHC--SL 69

  Fly    74 PTS-RLQVATGTIRYAEPGAVYYPDAIYLHCNYDSPKYQNDIGLLHLNESITFNALTQAVELPTS 137
            ||. ||.|....|: .|...::......:|.|:|:...:||:.|:.|:...|.:.....:.:...
  Rat    70 PTKIRLGVYRPNIK-NEKEQIHGYSLTVVHPNFDANIRKNDLMLIKLSYPATIDMYVGTIAIAME 133

  Fly   138 PFP------------------RGASELVFTGWGSQSAAGSLPSQLQRVQQQHLNSPACESMMSAY 184
            |..                  .....|.:|...|:|.:....:..|:.|:..:|.          
  Rat   134 PMVFNETCFIPTWTWNHYNNYSDPDTLTWTNQYSRSPSDCWNTLHQQRQETRINI---------- 188

  Fly   185 EDLELGPCHICAYRQANIGACHGD-SGGPLVHQGTLVGILNF-FVPCAQGVPDIFMNIMYYRDWM 247
                     :|.....|:.:...: |..|.:..|.:.|||:: ......|....|..|..|..|:
  Rat   189 ---------MCIGHSFNVKSSTKEVSAAPAICSGRVHGILSWGKAGITNGSEGFFTEIHPYARWI 244

  Fly   248 RQTM 251
            .:.|
  Rat   245 LRVM 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17477NP_650598.1 Tryp_SPc 27..250 CDD:238113 50/248 (20%)
Tryp_SPc 27..246 CDD:214473 49/244 (20%)
Tryx5XP_006236430.1 Tryp_SPc 37..244 CDD:419748 46/230 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166341225
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.