DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17477 and Prss58

DIOPT Version :9

Sequence 1:NP_650598.1 Gene:CG17477 / 42067 FlyBaseID:FBgn0038479 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001009174.1 Gene:Prss58 / 408204 RGDID:1303054 Length:240 Species:Rattus norvegicus


Alignment Length:253 Identity:61/253 - (24%)
Similarity:98/253 - (38%) Gaps:30/253 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LYCDL-LALEHFIVGGQNAAEGDAPYQVSLQTLLGSHL-CGGAIISDRWIITAGHCVKGYPTSRL 78
            ::|.| ..|..|.....:.|....||.|.|::   .:| |.|.:|...|::|:.||  ..|.  |
  Rat     4 VFCILSTLLGTFAYNPDHIAGTTPPYLVYLKS---DYLPCTGVLIHPLWVVTSAHC--NLPD--L 61

  Fly    79 QVATGTIRYAEPG----AVYYPDAIYLHCNYDSPKYQNDIGLLHLNESITFNALTQAVELPTSPF 139
            :|..|....|:..    .|...:.::.|..:.......|:.|:.|...|..:...:||:||....
  Rat    62 RVILGITNPADTTEHDVEVSDYEKMFRHPYFSVSSISYDLMLIKLRRGIKHSYYAKAVKLPQHTV 126

  Fly   140 PRGASELVFTGWGSQSAAGSLPSQLQRVQQQHLNSPACESMMSAYEDLELGPCHICAYRQANIG- 203
            |..|...|.|...:.......|..||.|....::...|.   :||:..::....||      :| 
  Rat   127 PVNAMCSVSTWAYNLCDVTKEPDSLQTVNVSVISKAECH---NAYKAFDIRENMIC------VGI 182

  Fly   204 ------ACHGDSGGPLVHQGTLVGILNFFVPCA-QGVPDIFMNIMYYRDWMRQTMSGN 254
                  .|...:..|.|..|.|.|||::...|. :....|:.:|.:|..|:...|..|
  Rat   183 VPGRRLPCKEVTAAPAVCNGVLYGILSYADGCVLRADVGIYASIFHYMPWIENIMKNN 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17477NP_650598.1 Tryp_SPc 27..250 CDD:238113 55/235 (23%)
Tryp_SPc 27..246 CDD:214473 54/231 (23%)
Prss58NP_001009174.1 Tryp_SPc 28..233 CDD:214473 53/220 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166341233
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.