DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17477 and CG7542

DIOPT Version :9

Sequence 1:NP_650598.1 Gene:CG17477 / 42067 FlyBaseID:FBgn0038479 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001287099.1 Gene:CG7542 / 39960 FlyBaseID:FBgn0036738 Length:270 Species:Drosophila melanogaster


Alignment Length:267 Identity:87/267 - (32%)
Similarity:119/267 - (44%) Gaps:26/267 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 ILVFSSLYCDLLA-LEHFIVGGQNAAEGDAPYQVSLQTLLG--SHLCGGAIISDRWIITAGHCVK 71
            :||.|.....||. :|.:|..|:.|..|..|||..|....|  |..|||.:||..|||||.||:.
  Fly     9 LLVGSCTAVPLLTDVEPYITNGEPAEVGQFPYQAGLNVSFGNWSTWCGGTLISHYWIITAAHCMD 73

  Fly    72 GYPTSRLQVATGTIRY---AEPG---AVYYPDAIYLHCNYDSPKYQNDIGLLHLNESITFNALTQ 130
            |  ...:.|..|.|..   :|.|   .:.....|.:|.||.:....|||.|:.|...:.|....:
  Fly    74 G--AESVTVYLGAINIGDESEEGQERIMVEKSGIIVHSNYMASTVVNDISLIRLPAFVGFTDRIR 136

  Fly   131 AVELP---TSPFPRGASELVF-TGWGSQS-AAGSLPSQLQRVQQQHLNSPACESMMSAYEDLELG 190
            |..||   ...||...|...| :|||.:| |:.|:...|:.|:...:....|....|.....:: 
  Fly   137 AASLPRRLNGQFPTYESIRAFASGWGRESDASDSVSPVLRYVEMPIMPHSLCRMYWSGAVSEKM- 200

  Fly   191 PCHICAYRQANIGACHGDSGGPLVH-QGT---LVGILNF--FVPCAQGVPDIFMNIMYYRDWMRQ 249
               ||....:....||||||||||: ||.   |:|..:|  .:.|..|.|.:|..|..|.||:..
  Fly   201 ---ICMSTTSGKSTCHGDSGGPLVYKQGNSSYLIGSTSFGTSMGCQVGFPAVFTRISSYLDWILN 262

  Fly   250 TMSGNGK 256
            .:..:.|
  Fly   263 HIIAHNK 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17477NP_650598.1 Tryp_SPc 27..250 CDD:238113 80/241 (33%)
Tryp_SPc 27..246 CDD:214473 78/237 (33%)
CG7542NP_001287099.1 Tryp_SPc 27..263 CDD:238113 80/241 (33%)
Tryp_SPc 27..260 CDD:214473 79/238 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.