DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17477 and Jon74E

DIOPT Version :9

Sequence 1:NP_650598.1 Gene:CG17477 / 42067 FlyBaseID:FBgn0038479 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster


Alignment Length:282 Identity:77/282 - (27%)
Similarity:127/282 - (45%) Gaps:44/282 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSLARFLFYILVF---SSLYCDLLALEH----FIVGGQNAAEGDAPYQVSLQTLLGSHL---CGG 55
            |.::..|.::|:.   .|:.|  |.:.|    .|.||:.|.....||||.|.....:.:   ||.
  Fly     1 MQISTILVFLLILVQGRSISC--LDMGHGIGGRIAGGELARANQFPYQVGLSIEEPNDMYCWCGA 63

  Fly    56 AIISDRWIITAGHCVKG------YPTSRLQVA-TGTIRYAEPGAVYYPDAIYLHCNYDSPKYQND 113
            ::||||:::||.|||:.      |....|::| ...||...|       .::||.:::....:||
  Fly    64 SLISDRYLLTAAHCVEKAVAITYYLGGVLRLAPRQLIRSTNP-------EVHLHPDWNCQSLEND 121

  Fly   114 IGLLHLNESITFNALTQAVELPTSPFPRGASELV---FTGWGSQS-AAGSLPSQLQRVQQQHLNS 174
            |.|:.|.|........:.:.||.....|.:.:.|   .:|||..: .:.::...|:.|.:...::
  Fly   122 IALVRLPEDALLCDSIRPIRLPGLSSSRNSYDYVPAIASGWGRMNDESTAISDNLRYVYRFVESN 186

  Fly   175 PACESMMSAYEDLELGPCHICAYRQANIGACHGDSGGPLVHQ------GTLVGILNFFVP--CAQ 231
            ..||     |....:.|.:||.........|.||||||||:.      ..|:|:.::...  |.:
  Fly   187 EDCE-----YSYANIKPTNICMDTTGGKSTCTGDSGGPLVYSDPVQNADILIGVTSYGKKSGCTK 246

  Fly   232 GVPDIFMNIMYYRDWMRQTMSG 253
            |.|.:|..|..|.||:.: :||
  Fly   247 GYPSVFTRITAYLDWIGE-VSG 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17477NP_650598.1 Tryp_SPc 27..250 CDD:238113 68/244 (28%)
Tryp_SPc 27..246 CDD:214473 66/240 (28%)
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 67/242 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.