DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17477 and CG11529

DIOPT Version :9

Sequence 1:NP_650598.1 Gene:CG17477 / 42067 FlyBaseID:FBgn0038479 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_648558.1 Gene:CG11529 / 39395 FlyBaseID:FBgn0036264 Length:287 Species:Drosophila melanogaster


Alignment Length:241 Identity:71/241 - (29%)
Similarity:110/241 - (45%) Gaps:30/241 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 PYQVSLQTLLGSH------LCGGAIISDRWIITAGHCVKGYPTSRLQVATGTIRYAE--PGAVYY 95
            ||||   .|:|..      ||||.::..|||:|||||..|.....:.:.|.::...|  .|.|..
  Fly    42 PYQV---MLIGKQLWRKRILCGGTLLDKRWILTAGHCTMGVTHYDVYLGTKSVEDTEVSGGLVLR 103

  Fly    96 PDAIYLHCNYDSPKYQNDIGLLHLNESITFNALTQAVELPT----SPFPRGASELVFTGWGSQSA 156
            .:...:|..::.....|||.|:.|.:.:.|....|...||:    ..|  ....:|.:|||:...
  Fly   104 SNKFIVHERFNPETAANDIALVKLPQDVAFTPRIQPASLPSRYRHDQF--AGMSVVASGWGAMVE 166

  Fly   157 AGSLPSQLQRVQQQHLNSPACESMMSAYEDLELGPCHICAYRQANIGACHGDSGGPLVHQGT--L 219
            ..:..| :|..:.:.:::..|   ...|:.:..|.  |||....:...|.||||||||.:.|  :
  Fly   167 MTNSDS-MQYTELKVISNAEC---AQEYDVVTSGV--ICAKGLKDETVCTGDSGGPLVLKDTQIV 225

  Fly   220 VGILNFFVP--CAQGVPDIFMNIMYYRDWMRQTMSGNGKCAQVNQQ 263
            |||.:|...  |...:|..|..:.:|.||:...:..:|   ||:||
  Fly   226 VGITSFGPADGCETNIPGGFTRVTHYLDWIESKIGSHG---QVHQQ 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17477NP_650598.1 Tryp_SPc 27..250 CDD:238113 66/226 (29%)
Tryp_SPc 27..246 CDD:214473 64/222 (29%)
CG11529NP_648558.1 Tryp_SPc 37..258 CDD:238113 66/226 (29%)
Tryp_SPc 37..255 CDD:214473 65/223 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.