DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17477 and CG18180

DIOPT Version :9

Sequence 1:NP_650598.1 Gene:CG17477 / 42067 FlyBaseID:FBgn0038479 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_648341.1 Gene:CG18180 / 39125 FlyBaseID:FBgn0036024 Length:264 Species:Drosophila melanogaster


Alignment Length:235 Identity:71/235 - (30%)
Similarity:101/235 - (42%) Gaps:26/235 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 IVGGQNAAEGDAPYQVSLQTLLGSHLCG----GAIISDRWIITAGHCVKGYPTSRLQVATGTIRY 87
            ||.|..|.||.|||.|.|.........|    |.||::.||:||.||:.|   ..:::..|: .:
  Fly    36 IVNGYPAPEGKAPYIVGLFIRTDGSNSGAVGAGTIIANDWILTAAHCLTG---DYVEIHYGS-NW 96

  Fly    88 AEPGA---VYYPDAIYLHCNYDSPKYQNDIGLLHLNESITFNALTQAVELPTSPFPRGASE---L 146
            ...||   ....|....|.::.| :...||||:. ...:.||.|...:.||:........:   .
  Fly    97 GWNGAYRQTVRRDNFISHPDWPS-QGGRDIGLIR-TPHVDFNGLINKIPLPSMNEQNDRYQDTWC 159

  Fly   147 VFTGWGSQSAAGSLPSQLQRVQQQHLNSPACESMMSAYEDLELGPCHICAYRQANIGACHGDSGG 211
            |..|||... .|:|...||.|..|.:::..||....:....::     |.........|.|||||
  Fly   160 VACGWGGMD-NGNLADWLQCVDVQIISNSECEQAYGSVASTDM-----CTRHADGKSVCGGDSGG 218

  Fly   212 PLV-HQGT-LVGILNF-FVPCAQGVPDIFMNIMYYRDWMR 248
            ||| |... |||::.| .|.|..| |..:..:..|.:|:|
  Fly   219 PLVTHDNARLVGVITFASVSCHDG-PSGYTRVSDYLEWIR 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17477NP_650598.1 Tryp_SPc 27..250 CDD:238113 71/235 (30%)
Tryp_SPc 27..246 CDD:214473 69/231 (30%)
CG18180NP_648341.1 Tryp_SPc 35..256 CDD:214473 69/232 (30%)
Tryp_SPc 36..259 CDD:238113 71/235 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.