DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17477 and CG18179

DIOPT Version :9

Sequence 1:NP_650598.1 Gene:CG17477 / 42067 FlyBaseID:FBgn0038479 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_648340.1 Gene:CG18179 / 39124 FlyBaseID:FBgn0036023 Length:268 Species:Drosophila melanogaster


Alignment Length:239 Identity:76/239 - (31%)
Similarity:107/239 - (44%) Gaps:34/239 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 IVGGQNAAEGDAPYQVSLQTLL---GSH---LCGGAIISDRWIITAGHCVKGYPTSRLQVATGTI 85
            ||.|..|.||.|||.|.|  |:   ||:   :..|.||:..||:||.||:   .|..:::..|: 
  Fly    40 IVNGYPAPEGKAPYIVGL--LIRTDGSNSAAVGAGTIIASDWILTAAHCL---TTDYVEIHYGS- 98

  Fly    86 RYAEPGAVYYP---DAIYLHCNYDSPKYQNDIGLLHLNESITFNALTQAVELPTSPFPRGASELV 147
            .:...||....   |....|.|:.: :...||||:. ..|:.|..|...|.||:  |...:...|
  Fly    99 NWGWNGAFRQSVRRDNFISHPNWPA-EGGRDIGLIR-TPSVGFTDLINKVALPS--FSEESDRFV 159

  Fly   148 FT-----GWGSQSAAGSLPSQLQRVQQQHLNSPACESMMSAYEDLELGPCHICAYRQANIGACHG 207
            .|     |||... .|:|...||.:..|.:::..||.........::     |..|.....:|.|
  Fly   160 DTWCVACGWGGMD-NGNLADWLQCMDVQIISNSECEQSYGTVASTDM-----CTRRTDGKSSCGG 218

  Fly   208 DSGGPLV-HQGT-LVGILNF-FVPCAQGVPDIFMNIMYYRDWMR 248
            ||||||| |... |||::.| .|.|..| |..:..:..|..|:|
  Fly   219 DSGGPLVTHDNARLVGVITFGSVDCHSG-PSGYTRVTDYLGWIR 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17477NP_650598.1 Tryp_SPc 27..250 CDD:238113 76/239 (32%)
Tryp_SPc 27..246 CDD:214473 74/235 (31%)
CG18179NP_648340.1 Tryp_SPc 39..260 CDD:214473 74/236 (31%)
Tryp_SPc 40..263 CDD:238113 76/239 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.