DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17477 and CG3088

DIOPT Version :9

Sequence 1:NP_650598.1 Gene:CG17477 / 42067 FlyBaseID:FBgn0038479 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_648334.1 Gene:CG3088 / 39115 FlyBaseID:FBgn0036015 Length:252 Species:Drosophila melanogaster


Alignment Length:247 Identity:60/247 - (24%)
Similarity:94/247 - (38%) Gaps:47/247 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 EHFIVGGQNAAEGDAPYQVSLQTLLGSHLCGGAIISDRWIITAGHCVKGYPTSRLQVATGTIRYA 88
            :|.|..|..|.||.|||.|.:.....:..|.|.||.|.||:|:..|:.|  :|.:.:..|..|.:
  Fly    26 DHIITNGSPAYEGQAPYVVGMAFGQSNIWCSGTIIGDTWILTSAQCLTG--SSGVTIYFGATRLS 88

  Fly    89 EPGAVYYPDAIYLHCNYDSPKYQNDIGLLHLNESITFNALTQAVELPTSPFPRGASELVF----- 148
            :                  .::...:|   .:|.:|.|.....|.:|...|....:.:..     
  Fly    89 Q------------------AQFTVTVG---TSEYVTGNQHLALVRVPRVGFSNRVNRVALPSLRN 132

  Fly   149 ------------TGWGSQSAAGSLPSQLQRVQQQHLNSPACESMMSAYEDLELGPCHICAYRQAN 201
                        .|||..:.:..|...||.|..|.:::..|   ::.|....:....:|....:.
  Fly   133 RSQRYENWWANVCGWGVTTFSNGLTDALQCVDLQIMSNNEC---IAFYGSTTVSDQILCTRTPSG 194

  Fly   202 IGACHGDSGGPLV--HQGTLVGILNFFVP--CAQGVPDIFMNIMYYRDWMRQ 249
            ...|.||:|.||:  ...|:|||..|...  |..|:|..|..|....||:.|
  Fly   195 RSTCFGDAGSPLITKQDSTVVGISAFVASNGCTLGLPAGFARITSALDWIHQ 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17477NP_650598.1 Tryp_SPc 27..250 CDD:238113 59/244 (24%)
Tryp_SPc 27..246 CDD:214473 56/239 (23%)
CG3088NP_648334.1 Tryp_SPc 29..246 CDD:238113 58/242 (24%)
Tryp_SPc 29..244 CDD:214473 57/240 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.