DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17477 and Jon66Cii

DIOPT Version :9

Sequence 1:NP_650598.1 Gene:CG17477 / 42067 FlyBaseID:FBgn0038479 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster


Alignment Length:232 Identity:75/232 - (32%)
Similarity:106/232 - (45%) Gaps:27/232 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 IVGGQNAAEGDAPYQVSLQTLLGSHLCGGAIISDRWIITAGHCVKGYPTSRLQVATGTIRYAEPG 91
            |..|..|.||.|||.|.| ...|...|||:||:..|::||.||:.       ...:.|:.:   |
  Fly    40 ITNGYPAEEGKAPYTVGL-GFSGGWWCGGSIIAHDWVLTAEHCIG-------DADSVTVYF---G 93

  Fly    92 AVYYPDAIYLHC--NYDSPKYQN-DIGLLHLNESITFNALTQAVELPT-SPFPRGASE--LVFTG 150
            |.:..:|.:.|.  |.:..|:.: ||.|:.: ..:.|..:...||||: :......:|  .|..|
  Fly    94 ATWRTNAQFTHWVGNGNFIKHSSADIALIRI-PHVDFWHMVNKVELPSYNDRYNDYNEWWAVACG 157

  Fly   151 WGSQSAAGSLPSQLQRVQQQHLNSPACESMMSAYEDLELGPCHICAYRQANIGACHGDSGGPLV- 214
            ||.......||..||.|..|.:::..|.....:     :|...:|.........|.|||||||| 
  Fly   158 WGGTYDGSPLPDYLQCVDLQIIHNSECSGYYGS-----VGDNILCVRTPDGKSTCGGDSGGPLVT 217

  Fly   215 HQGT-LVGILNF--FVPCAQGVPDIFMNIMYYRDWMR 248
            |.|| |||:.||  ...|..|.|..|..:.|:.||:|
  Fly   218 HDGTKLVGVTNFGSVAGCQSGAPAGFQRVTYHLDWIR 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17477NP_650598.1 Tryp_SPc 27..250 CDD:238113 75/232 (32%)
Tryp_SPc 27..246 CDD:214473 72/228 (32%)
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 73/229 (32%)
Tryp_SPc 40..256 CDD:238113 75/232 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.