DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17477 and CG33465

DIOPT Version :9

Sequence 1:NP_650598.1 Gene:CG17477 / 42067 FlyBaseID:FBgn0038479 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001033950.2 Gene:CG33465 / 3885587 FlyBaseID:FBgn0053465 Length:488 Species:Drosophila melanogaster


Alignment Length:245 Identity:52/245 - (21%)
Similarity:96/245 - (39%) Gaps:43/245 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 NAAEGDAPYQVSLQTLLGSHLCGGAIISDRWIITAGHCVKGYPTSRLQVATGTIRYAEPGAVYYP 96
            :.|...||:..|:.. ....:|.|.::...:::||..|:.  ..|:|.|..|........:.::.
  Fly    39 HGATETAPWMASIYK-NNQFICDGTLVHKLFVLTAASCIS--KDSQLYVLFGMYNQYRDASQFFN 100

  Fly    97 DAIY------LHCNYDSPKYQNDIGLLHLNESITFNALTQAV------ELPTSPFPRGASELVFT 149
            :..|      .|.|:......||||||.|...:|..|..:.:      .:.::||.|      |.
  Fly   101 NEQYGVAVALQHSNFRPNNGVNDIGLLRLYGEVTHYAHIRPICIILDHVVKSAPFER------FE 159

  Fly   150 GWGSQSAAGSLPSQLQRVQQQHLNSPACESMMSAYEDLELGPCH---ICAYRQANIGACHGDSGG 211
            |:|.|.......||:::........|     ...:.:.:|.|.:   .||..: :...|..:||.
  Fly   160 GFGWQQQGTEASSQVRQTVYLSQKKP-----FECHRNGQLLPINEGQFCAGNR-DRSFCRSNSGS 218

  Fly   212 PLVHQGTLVGILNFFVP----------CAQGVPDIFMNIMYYRDWMRQTM 251
            ||....| .|:.|..|.          |:.  ..::.:::.::||:..|:
  Fly   219 PLTADFT-YGVKNITVQVGLVSYGSELCSP--TSVYTDVVAFKDWIYNTV 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17477NP_650598.1 Tryp_SPc 27..250 CDD:238113 51/242 (21%)
Tryp_SPc 27..246 CDD:214473 49/238 (21%)
CG33465NP_001033950.2 Tryp_SPc 46..264 CDD:238113 49/235 (21%)
Tryp_SPc 46..261 CDD:214473 48/232 (21%)
Tryp_SPc 293..484 CDD:304450
Tryp_SPc 293..481 CDD:214473
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.