DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17477 and CG10472

DIOPT Version :9

Sequence 1:NP_650598.1 Gene:CG17477 / 42067 FlyBaseID:FBgn0038479 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_648017.1 Gene:CG10472 / 38688 FlyBaseID:FBgn0035670 Length:290 Species:Drosophila melanogaster


Alignment Length:241 Identity:83/241 - (34%)
Similarity:111/241 - (46%) Gaps:24/241 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 IVGGQNAAEGDAPYQVSLQTLL--GSHLCGGAIISDRWIITAGHCVKGYPTSRLQVATG----TI 85
            |.|||.|.....||||.|...:  |:..|||.||||||||||.||.... |:.:.|..|    |.
  Fly    47 ITGGQIAEPNQFPYQVGLLLYITGGAAWCGGTIISDRWIITAAHCTDSL-TTGVDVYLGAHDRTN 110

  Fly    86 RYAEPGAVYYPDA--IYLHCNYDSPKYQNDIGLLHLNESITFNALTQAVELPT---SPFPRGASE 145
            ...|...:.:.:.  :.:|.::.:....|||.|:.|...|.||...|..:||.   |....|...
  Fly   111 AKEEGQQIIFVETKNVIVHEDWIAETITNDISLIKLPVPIEFNKYIQPAKLPVKSDSYSTYGGEN 175

  Fly   146 LVFTGWG--SQSAAGSLPSQLQRVQQQHLNSPACESMMSAYEDLELGPCHICAYRQANIGACHGD 208
            .:.:|||  |.||.|: ...||......:|:..|...   |..| :...:||......|..|:||
  Fly   176 AIASGWGKISDSATGA-TDILQYATVPIMNNSGCSPW---YFGL-VAASNICIKTTGGISTCNGD 235

  Fly   209 SGGPLV---HQGTLVGILNFFVP--CAQGVPDIFMNIMYYRDWMRQ 249
            ||||||   ...||:|..:|.:.  |..|.|.:|..|.||.||:.:
  Fly   236 SGGPLVLDDGSNTLIGATSFGIALGCEVGWPGVFTRITYYLDWIEE 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17477NP_650598.1 Tryp_SPc 27..250 CDD:238113 83/241 (34%)
Tryp_SPc 27..246 CDD:214473 81/236 (34%)
CG10472NP_648017.1 Tryp_SPc 46..279 CDD:214473 82/237 (35%)
Tryp_SPc 47..282 CDD:238113 83/241 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.