DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17477 and CG6592

DIOPT Version :9

Sequence 1:NP_650598.1 Gene:CG17477 / 42067 FlyBaseID:FBgn0038479 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_648016.1 Gene:CG6592 / 38687 FlyBaseID:FBgn0035669 Length:438 Species:Drosophila melanogaster


Alignment Length:255 Identity:73/255 - (28%)
Similarity:113/255 - (44%) Gaps:54/255 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 IVGGQNAAEGDAPYQVS--LQTLLGSHLCGGAIISDRWIITAGHCVKGYPTSRLQVATGTIRYA- 88
            |.||........||||.  ||...|.:.|||::|||:.:|||.|||.....:.:.:....|:.| 
  Fly   123 IFGGDVGNPHCFPYQVGMLLQRPKGLYWCGGSLISDKHVITAAHCVDMAKRALVFLGANEIKNAK 187

  Fly    89 EPGAV----------YYPDAIYLHCNYDSPKYQNDIGLLHLNESITFNALTQAVELPTSPFPRGA 143
            |.|.|          .||       .::..:.::||.::.|..:::||.....::||...:...:
  Fly   188 EKGQVRLMVPSENFQIYP-------TWNPKRLKDDIAIVRLPHAVSFNERIHPIQLPKRHYEYRS 245

  Fly   144 SE---LVFTGWGSQSAAG--SLPSQLQRVQQQHLNSPACESMMSAYEDLELGPCHICAYRQANI- 202
            .:   .:.:||| :.|.|  ::.:.|:.||.|.::...|:|...            .:||..|| 
  Fly   246 FKNKLAIASGWG-RYATGVHAISNVLRYVQLQIIDGRTCKSNFP------------LSYRGTNIC 297

  Fly   203 -------GACHGDSGGPLVHQ------GTLVGILNF--FVPCAQGVPDIFMNIMYYRDWM 247
                   ..|:||||||||.|      ..||||.:|  ...|.:|.|..|..:..|.||:
  Fly   298 TSGRNARSTCNGDSGGPLVLQRRHSKKRVLVGITSFGSIYGCDRGYPAAFTKVASYLDWI 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17477NP_650598.1 Tryp_SPc 27..250 CDD:238113 73/255 (29%)
Tryp_SPc 27..246 CDD:214473 71/252 (28%)
CG6592NP_648016.1 Tryp_SPc 122..357 CDD:214473 72/253 (28%)
Tryp_SPc 123..359 CDD:238113 73/255 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.