DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17477 and Jon65Aiv

DIOPT Version :9

Sequence 1:NP_650598.1 Gene:CG17477 / 42067 FlyBaseID:FBgn0038479 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_648012.1 Gene:Jon65Aiv / 38682 FlyBaseID:FBgn0250815 Length:271 Species:Drosophila melanogaster


Alignment Length:235 Identity:69/235 - (29%)
Similarity:108/235 - (45%) Gaps:19/235 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 IVGGQNAAEGDAPYQVSLQ---TLLGSHLCGGAIISDRWIITAGHCVKGYPTSRLQVATGTIRYA 88
            |.||.|||.|..||||.|.   :.|.|..|||::|...|::||.||..|..:..:.:.......|
  Fly    38 ITGGSNAAVGQFPYQVGLSLKLSALSSAWCGGSLIGSTWVLTAAHCTDGVQSVTVYLGATVRTSA 102

  Fly    89 EPGAVYYPDAIYLHCNYDSPKYQNDIGLLHLNESITFNALTQAVELPT-----SPFPRGASELVF 148
            |.........|.:|..::|...:|||.|:.:..:.:.:.:: ||:||:     |.|....:  |.
  Fly   103 EITHTVSSSDIIIHSGWNSANLRNDISLIKIPATSSSSRIS-AVKLPSISNSYSTFVGDVA--VA 164

  Fly   149 TGWGSQSAAGS-LPSQLQRVQQQHLNSPACESMMSAYEDLELGPCHICAYRQANIGACHGDSGGP 212
            :|||..|...| :.:.||.|....:.:..|   ...|....:....:|.........|:||||||
  Fly   165 SGWGRTSDTSSGVATNLQYVDLTVITNTKC---AQTYGTSVVTDSTLCVATTDAKSTCNGDSGGP 226

  Fly   213 LVHQGT--LVGILNF--FVPCAQGVPDIFMNIMYYRDWMR 248
            ||.:.:  .:|:.:|  ...|.:|.|..|..:..|.||::
  Fly   227 LVLKSSSEQIGLTSFGASAGCEKGYPAAFTRVTSYLDWIK 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17477NP_650598.1 Tryp_SPc 27..250 CDD:238113 69/235 (29%)
Tryp_SPc 27..246 CDD:214473 67/231 (29%)
Jon65AivNP_648012.1 Tryp_SPc 37..265 CDD:214473 68/232 (29%)
Tryp_SPc 38..268 CDD:238113 69/235 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.