DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17477 and yip7

DIOPT Version :9

Sequence 1:NP_650598.1 Gene:CG17477 / 42067 FlyBaseID:FBgn0038479 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_523944.1 Gene:yip7 / 38680 FlyBaseID:FBgn0040060 Length:270 Species:Drosophila melanogaster


Alignment Length:275 Identity:79/275 - (28%)
Similarity:116/275 - (42%) Gaps:41/275 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 FLFYILVFSSLYCDLL---------------ALEHFIVGGQNAAEGDAPYQV--SLQTLLGSHLC 53
            |:..:|..:|....||               ::...|..|::|..|..||||  |..:..||..|
  Fly     4 FVVLVLALASASAGLLPNIAPVHPRDRVSTPSITGRITNGKDAVAGQFPYQVGLSFSSSAGSWWC 68

  Fly    54 GGAIISDRWIITAGHCVKGYPTSRLQVATGTIRYA-------EPGAVYYPDAIYLHCNYDSPKYQ 111
            ||:||.:.|::||.||..|       .|:.||.|.       |...|........|.:|.:...:
  Fly    69 GGSIIGNEWVLTAAHCTDG-------AASVTIYYGATVRTSPEFTQVVSSSKFRQHESYLALTIR 126

  Fly   112 NDIGLLHLNESITFNALTQAVELPTSPFPRGASE---LVFTGWG-SQSAAGSLPSQLQRVQQQHL 172
            |||.|:. ..|::|:|....:.||.........|   .|.:||| :...|.::...||.|....:
  Fly   127 NDISLIQ-TSSVSFSATVNKISLPAVSNSYSTYEGKTAVASGWGLTSDQATAVSRDLQYVDLTII 190

  Fly   173 NSPACESMMSAYEDLELGPCHICAYRQANIGACHGDSGGPLVHQGTLVGILNFFVP--CAQGVPD 235
            ::..|:   ..:..|.:....:|.........|.|||||||...|.|:|..:|...  |..|.|.
  Fly   191 SNSKCQ---ETFGSLIVTSRVLCVDTTNKASTCQGDSGGPLALDGVLIGATSFGSADGCESGAPA 252

  Fly   236 IFMNIMYYRDWMRQT 250
            .|..|.|||||:::|
  Fly   253 AFTRITYYRDWIKET 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17477NP_650598.1 Tryp_SPc 27..250 CDD:238113 73/237 (31%)
Tryp_SPc 27..246 CDD:214473 71/233 (30%)
yip7NP_523944.1 Tryp_SPc 39..264 CDD:214473 72/235 (31%)
Tryp_SPc 40..267 CDD:238113 73/237 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.