DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17477 and CG15873

DIOPT Version :9

Sequence 1:NP_650598.1 Gene:CG17477 / 42067 FlyBaseID:FBgn0038479 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_611910.2 Gene:CG15873 / 37898 FlyBaseID:FBgn0035003 Length:297 Species:Drosophila melanogaster


Alignment Length:302 Identity:75/302 - (24%)
Similarity:115/302 - (38%) Gaps:75/302 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LARFLFYILVFSSLYCDLLAL--------EHFIVGGQNAAEGD-APYQVSLQTLL------GSHL 52
            |..||..||..|....||..:        |..|.||....... :.:.||::|..      .:|.
  Fly     4 LTVFLGLILSTSLSDADLGVIGDISDETFEMLISGGYKPKSNRLSRHVVSIRTKNYVRHRGDNHF 68

  Fly    53 CGGAIISDRWIITAGHCVKG-YPTSR----LQVATGTIRYAEPGAVY------YPDAIYLHCNYD 106
            |.|.::|.|.::||.||:.. |..|.    ::|..|.|...   |||      ..|.:.:|..|:
  Fly    69 CSGVLVSSRAVLTAAHCLTDRYKASMNPRGIRVVFGHITRL---AVYDESDFRSVDRLVVHPEYE 130

  Fly   107 SPKYQNDIGLLHLNESITFNALTQAVELPTSP-FPRGASELVF------TGWGSQSAAGSLPSQL 164
            ..| :||:.:|.|:|.:      |:......| ..|..:.:.:      .|||.....|...::|
  Fly   131 RYK-KNDLAILRLSERV------QSSNHDVLPLLMRKTANVTYGDTCITLGWGQIYQHGPYSNEL 188

  Fly   165 QRVQQQHLNSPACESMMSAYEDLELGPCHICAYRQANIGA--------------CHGDSGGPLVH 215
                              .|.|:.|.|..:|........|              |.||.||||:.
  Fly   189 ------------------VYLDVILRPPSLCQKHYDTFTADHNVCTEPVGESMNCAGDMGGPLLC 235

  Fly   216 QGTLVGILNFFVPCAQGVPDIFMNIMYYRDWMRQTMSGNGKC 257
            :|.|.|::...:.||.|....|::.:||:||:..|:.....|
  Fly   236 KGALFGLIGGHMGCAGGKAMKFLSFLYYKDWILLTIQSLSDC 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17477NP_650598.1 Tryp_SPc 27..250 CDD:238113 64/261 (25%)
Tryp_SPc 27..246 CDD:214473 62/257 (24%)
CG15873NP_611910.2 Tryp_SPc 36..250 CDD:214473 56/241 (23%)
Tryp_SPc 59..250 CDD:238113 50/218 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.