DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17477 and CG30283

DIOPT Version :9

Sequence 1:NP_650598.1 Gene:CG17477 / 42067 FlyBaseID:FBgn0038479 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_611587.2 Gene:CG30283 / 37454 FlyBaseID:FBgn0260477 Length:273 Species:Drosophila melanogaster


Alignment Length:250 Identity:68/250 - (27%)
Similarity:113/250 - (45%) Gaps:31/250 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 CDLLALEHF-IVGGQNAAEGDAPYQVSLQTLLGSHLCGGAIISDRWIITAGHCVKGYPTSRLQVA 81
            |..:.:..| |:||.||....||:...:....|.| |||.:|::|:::|:.||:   ....|:|.
  Fly    33 CGTVPISQFKILGGHNAPVASAPWMAMVMGEGGFH-CGGTLITNRFVLTSAHCI---ANGELKVR 93

  Fly    82 TGTIRYAEPGAVYYPDAIYLHCNYDSPKY--QNDIGLLHLNESITFNALTQAVELPTSPFPRGAS 144
            .|.:........:..||:::|.:|    |  |:|:.||.|.:.:.::.....:.|...|..:...
  Fly    94 LGVLEREAEAQKFAVDAMFVHTDY----YFDQHDLALLRLAKRVHYSDNISPICLLLDPLVKNID 154

  Fly   145 ELVFT----GWGSQSAAGSLPSQLQRVQQQHLNSPACESMMSAYEDLELGPCHICAYRQANIGAC 205
            |.:..    |||...:..| ...||:....:|:...|...   |...::...|||| ..||...|
  Fly   155 EHIVKFRTYGWGKTESRSS-SRMLQKTSLFNLHRSECAKQ---YPHQQINRNHICA-ESANANTC 214

  Fly   206 HGDSGGPL--------VHQGTLVGILNF-FVPCAQGVPDIFMNIMYYRDWMRQTM 251
            :|||||||        |......|:.:| ...|::..  :|.|:|.:.||:..|:
  Fly   215 NGDSGGPLTAIVTYDHVQMVFQFGVTSFGHADCSKAT--VFTNVMTHLDWIVNTV 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17477NP_650598.1 Tryp_SPc 27..250 CDD:238113 65/237 (27%)
Tryp_SPc 27..246 CDD:214473 63/233 (27%)
CG30283NP_611587.2 Tryp_SPc 42..263 CDD:214473 64/235 (27%)
Tryp_SPc 43..266 CDD:238113 65/237 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.