DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17477 and CG10764

DIOPT Version :9

Sequence 1:NP_650598.1 Gene:CG17477 / 42067 FlyBaseID:FBgn0038479 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_611213.2 Gene:CG10764 / 36962 FlyBaseID:FBgn0034221 Length:523 Species:Drosophila melanogaster


Alignment Length:280 Identity:85/280 - (30%)
Similarity:132/280 - (47%) Gaps:44/280 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 RFLFYILVFSSLYCDLLALEHF--------------IVGGQNAAEGDAPYQVSLQTLLGS--HLC 53
            |.|..:.:.|.|...:...|||              |.||.:|||   |..:.:..:..|  ..|
  Fly     2 RSLVSVALLSLLTLCVTENEHFKFLETPCGISTRPKISGGDDAAE---PNSIWMAAIFNSSDFQC 63

  Fly    54 GGAIISDRWIITAGHC-VKGYPTSRLQVATGTIRYAEPGAVYYPDAIYLHCNYDSPKYQNDIGLL 117
            ||.||..|::::|.|| |:||.   |.|..|.....||.||:....:::|.::.:.:|:||||||
  Fly    64 GGTIIHMRFVLSAAHCLVRGYD---LYVRLGARNINEPAAVHTVINVFVHHDFIASEYRNDIGLL 125

  Fly   118 HLNESITFNALTQAVELPTSPFPRGASELVFT----GWGSQSAAGSLPSQLQRVQQQHLNSPACE 178
            .|:|||.:....|.:.:...|..:|:.|.:.|    |||:::  |.|...||.:...||....|:
  Fly   126 QLSESIVYTVRVQPICIFLDPALKGSVEKLKTFRALGWGNRN--GKLSIMLQTIYLLHLKRNECK 188

  Fly   179 SMMSAYEDLELGPCHICAYRQANIGACHGDSGGPL---------VHQGTLVGILNFFVPCAQGVP 234
            ..:    :..|....|||..: |...|.|||||||         ......:||::|..|..:|| 
  Fly   189 RKL----NFNLNSRQICAGTK-NGDTCRGDSGGPLSTNILFPSNKSYEVQLGIVSFGDPECRGV- 247

  Fly   235 DIFMNIMYYRDWMRQTMSGN 254
            .::.::..|.||:..|::.|
  Fly   248 GVYTDVTSYVDWISSTIARN 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17477NP_650598.1 Tryp_SPc 27..250 CDD:238113 76/238 (32%)
Tryp_SPc 27..246 CDD:214473 74/234 (32%)
CG10764NP_611213.2 Tryp_SPc 37..260 CDD:214473 75/236 (32%)
Tryp_SPc 38..263 CDD:238113 76/238 (32%)
Tryp_SPc 317..512 CDD:214473
Tryp_SPc 317..512 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.