DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17477 and CG4927

DIOPT Version :10

Sequence 1:NP_650598.1 Gene:CG17477 / 42067 FlyBaseID:FBgn0038479 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001033953.1 Gene:CG4927 / 36852 FlyBaseID:FBgn0034139 Length:362 Species:Drosophila melanogaster


Alignment Length:52 Identity:14/52 - (26%)
Similarity:15/52 - (28%) Gaps:20/52 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 GESYENCSPWLSYATAKNKTCYNLCVHNCAAVYDGSCINDRRFKCCLATFPA 85
            |..||..| | .||...|             |.|..|:     .|....|.|
  Fly   456 GLKYEEFS-W-EYAKPSN-------------VNDPECL-----PCIFLQFGA 487

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17477NP_650598.1 Tryp_SPc 27..250 CDD:238113 14/52 (27%)
CG4927NP_001033953.1 Tryp_SPc 105..358 CDD:238113
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.