DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17477 and CG8299

DIOPT Version :9

Sequence 1:NP_650598.1 Gene:CG17477 / 42067 FlyBaseID:FBgn0038479 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_611066.1 Gene:CG8299 / 36751 FlyBaseID:FBgn0034052 Length:260 Species:Drosophila melanogaster


Alignment Length:258 Identity:84/258 - (32%)
Similarity:133/258 - (51%) Gaps:13/258 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSLARFLFYILVFS-SLYCDLLALEHFIVGGQNAAEGDAPYQVS--LQTLLGSHLCGGAIISDRW 62
            |||...||.:.... .:..|..::...||||..|...|.|||||  |:|.:..|:|||:|.:.|.
  Fly     1 MSLRLGLFLLAALGVVILTDSASISTHIVGGDQADIADFPYQVSVRLETYMLLHICGGSIYAPRV 65

  Fly    63 IITAGHCVKGYPTSRLQVATGTIRYA---EPGAVYYPDAIYLHCNYDSPKYQNDIGLLHLNESIT 124
            :|||.||:||...|.:::..|....|   |.|...  ..:..|..|:...|.|||||:...|.:.
  Fly    66 VITAAHCIKGRYASYIRIVAGQNSIADLEEQGVKV--SKLIPHAGYNKKTYVNDIGLIITREPLE 128

  Fly   125 FNALTQAVELPTSPFPRGASELVFTGWGSQSAAG-SLPSQLQRVQQQHLNSPACESMMSAYEDLE 188
            ::||.|.:.:.....|.|| :.|.:|||.::... :||:.|:.|:.|.:....|.:.... :|..
  Fly   129 YSALVQPIAVALEAPPSGA-QAVVSGWGKRAEDDEALPAMLRAVELQIIEKSTCGAQYLT-KDYT 191

  Fly   189 LGPCHICA-YRQANIGACHGDSGGPLVHQGTLVGILNFFVPCA-QGVPDIFMNIMYYRDWMRQ 249
            :....:|| |.:.....|:|||||||...|.|||::::.|.|. :|.|.::.::..:.||:.:
  Fly   192 VTDEMLCAGYLEGGKDTCNGDSGGPLAVDGVLVGVVSWGVGCGREGFPGVYTSVNSHIDWIEE 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17477NP_650598.1 Tryp_SPc 27..250 CDD:238113 78/231 (34%)
Tryp_SPc 27..246 CDD:214473 76/226 (34%)
CG8299NP_611066.1 Tryp_SPc 27..252 CDD:214473 77/228 (34%)
Tryp_SPc 28..255 CDD:238113 78/231 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.