DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17477 and thetaTry

DIOPT Version :9

Sequence 1:NP_650598.1 Gene:CG17477 / 42067 FlyBaseID:FBgn0038479 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_523693.1 Gene:thetaTry / 36218 FlyBaseID:FBgn0011555 Length:262 Species:Drosophila melanogaster


Alignment Length:224 Identity:80/224 - (35%)
Similarity:123/224 - (54%) Gaps:6/224 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 IVGGQNAAEGDAPYQVSLQTLLGSHLCGGAIISDRWIITAGHCVKGYPTSRLQVATGTIRYAEPG 91
            ||||::...|..||||||||..|||.|||::|::..::||.||:.|...|::.|..|:..|.|.|
  Fly    35 IVGGEDTTIGAHPYQVSLQTKSGSHFCGGSLINEDTVVTAAHCLVGRKVSKVFVRLGSTLYNEGG 99

  Fly    92 AVYYPDAIYLHCNYDSPKYQNDIGLLHLNESITFNALTQAVELPTSPFPRGASELVFTGWGSQSA 156
            .|.....:..:.:|:|...:.|:|:|.|:|.:......:.:||.|...|.|.:.:| |||||:..
  Fly   100 IVVAVRELAYNEDYNSKTMEYDVGILKLDEKVKETENIRYIELATETPPTGTTAVV-TGWGSKCY 163

  Fly   157 --AGSLPSQLQRVQQQHLNSPACESMMSAYEDLELGPCHICAYRQANIGACHGDSGGPLVHQGTL 219
              ..:||..||.|....::...|.|....|.:: :....:|||.:.. .||.|||||||....||
  Fly   164 FWCMTLPKTLQEVYVNIVDWKTCASDEYKYGEI-IYDSMVCAYEKKK-DACQGDSGGPLAVGNTL 226

  Fly   220 VGILNFFVPCAQG-VPDIFMNIMYYRDWM 247
            |||:::...||.. :|.::.::...|.|:
  Fly   227 VGIVSWGYACASNLLPGVYSDVPALRKWI 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17477NP_650598.1 Tryp_SPc 27..250 CDD:238113 80/224 (36%)
Tryp_SPc 27..246 CDD:214473 79/221 (36%)
thetaTryNP_523693.1 Tryp_SPc 34..255 CDD:214473 79/222 (36%)
Tryp_SPc 35..255 CDD:238113 79/222 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.