DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17477 and CG12133

DIOPT Version :9

Sequence 1:NP_650598.1 Gene:CG17477 / 42067 FlyBaseID:FBgn0038479 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_610540.2 Gene:CG12133 / 36036 FlyBaseID:FBgn0033469 Length:340 Species:Drosophila melanogaster


Alignment Length:283 Identity:67/283 - (23%)
Similarity:112/283 - (39%) Gaps:77/283 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 FIVGGQNAAEGDAPYQVSLQTLLG----------SHLCGGAIISDRWIITAGHC--VKGYPTSRL 78
            :||||..|.....|:.|    |||          |.:|.|::|:.|:::||.||  |..:..:| 
  Fly    61 YIVGGMEAQSNQFPWTV----LLGYEAYTAKQRPSPMCAGSLIASRYVLTAAHCLNVNDFYVAR- 120

  Fly    79 QVATGTIRYAEPGAVYYPDAIYL----------HCNYD-------------SPKYQNDIGLLHLN 120
                  :|..|......||..:|          |.:.|             :.::.|||.||.|.
  Fly   121 ------VRLGEHDTENDPDYTWLPNGAKIWAPAHVDIDVDLRVPHEQYYTRNGRHYNDIALLRLK 179

  Fly   121 ESITFN------ALTQAVELPTSPFPRGASELVFTGWGSQSAAGSLPSQLQR----VQQQHLNSP 175
            ..:.:.      .:...:||.||.|.....::  .|||.        |.||:    ::|..::..
  Fly   180 SRVKYTLQIRPICIWPGIELSTSSFKNFPFQI--AGWGD--------SGLQQKSTVLRQGTISGM 234

  Fly   176 ACESMMSAYEDLELG-PCHICAYRQANIGACHGDSGGPL---VHQGT-----LVGILNF-FVPCA 230
            :.:..::.|..|.:. ...|||..........||||.||   |.:|.     |.||.:: ..|.:
  Fly   235 SPDECLNRYPTLLVDKDIQICAMGWDGTDTGLGDSGSPLMASVGRGADQFYYLAGITSYGGGPSS 299

  Fly   231 QGV-PDIFMNIMYYRDWMRQTMS 252
            .|. |.::.....|.:|:::.::
  Fly   300 YGYGPAVYTKTSSYYEWIKKKIN 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17477NP_650598.1 Tryp_SPc 27..250 CDD:238113 67/278 (24%)
Tryp_SPc 27..246 CDD:214473 66/274 (24%)
CG12133NP_610540.2 Tryp_SPc 62..320 CDD:238113 67/278 (24%)
Tryp_SPc 62..317 CDD:214473 66/275 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.