DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17477 and CG4650

DIOPT Version :9

Sequence 1:NP_650598.1 Gene:CG17477 / 42067 FlyBaseID:FBgn0038479 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_609722.2 Gene:CG4650 / 34859 FlyBaseID:FBgn0032549 Length:299 Species:Drosophila melanogaster


Alignment Length:291 Identity:57/291 - (19%)
Similarity:111/291 - (38%) Gaps:66/291 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSLARFLFYILV-FSSLY----CDLLALEHFIVGGQNAAEGDAPYQVSLQTLLGSHLCGGAIISD 60
            :.::..||.:.| .||.|    |.||      ..|:.|....:|:...|.|....::|||.:|::
  Fly     6 IGISALLFLLPVPGSSQYLDGRCGLL------TNGKIANNISSPWMAYLHTSELLYVCGGTVITE 64

  Fly    61 RWIITAGHCVKGYPTSRLQVATGTIRYAEPG-----AVYYPDAIYLHCNYDSPKYQNDIGLLHLN 120
            :.::||.||.:.  :.:|....|.....:..     :.|.....::|..|::....|||.:|.|.
  Fly    65 KLVLTAAHCTRA--SEQLVARIGEFIGTDDANDTMLSEYQVSQTFIHSLYNTTTSANDIAILGLA 127

  Fly   121 ESITFNALTQAVELPTSPFPRGASELVFTGWGS--------QSAAGSLPS--------QLQRVQQ 169
            ..|.|:...:.:.:           :.:|.|..        ..|...||:        ::..:::
  Fly   128 TDIVFSKTIRPICI-----------VWWTIWRKYIDNIQVLSGAQWGLPNDRNESDAFRITDIRR 181

  Fly   170 QHLNSPACESMMSAYEDLELGPCHICAYRQANIGACHGDSGGPL--------VHQGTLVGILNFF 226
            |..|      |.|......:.....|| ..::...|:.|...||        :.:..|:||....
  Fly   182 QPAN------MCSTLNGTAILSSQFCA-GDSDSKLCNVDFSSPLGAIITFKNIQRYVLIGIATTN 239

  Fly   227 VPCAQGVPDIFMNIMYYRDWM----RQTMSG 253
            ..|.:.  .::.:::.:.|::    ||..:|
  Fly   240 QKCKRA--SVYTDVLSHTDFILSVWRQYRNG 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17477NP_650598.1 Tryp_SPc 27..250 CDD:238113 46/255 (18%)
Tryp_SPc 27..246 CDD:214473 44/247 (18%)
CG4650NP_609722.2 Tryp_SPc 33..258 CDD:214473 45/246 (18%)
Tryp_SPc 33..258 CDD:304450 45/246 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.