DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17477 and PRSS38

DIOPT Version :9

Sequence 1:NP_650598.1 Gene:CG17477 / 42067 FlyBaseID:FBgn0038479 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_898885.1 Gene:PRSS38 / 339501 HGNCID:29625 Length:326 Species:Homo sapiens


Alignment Length:256 Identity:72/256 - (28%)
Similarity:118/256 - (46%) Gaps:28/256 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 ILVFSSLYCDLLALEHFIVGGQNAAEGDAPYQVSLQTLLGSHLCGGAIISDRWIITAGHC----- 69
            |.:..|:.|...::|..|:||..|.|...|:|||:. ..|.|:|||:|:::.|:::|.||     
Human    43 ISLTGSVACGRPSMEGKILGGVPAPERKWPWQVSVH-YAGLHVCGGSILNEYWVLSAAHCFHRDK 106

  Fly    70 -VKGYPTSRLQVATGTIRYAEPGAVYYP-DAIYLHCNYDSPKYQ---NDIGLLHLNESITFNALT 129
             :|.|.   :.|....:|.|.....:|. :.:.||..|:  .|.   .|:.|:.|...|.|:...
Human   107 NIKIYD---MYVGLVNLRVAGNHTQWYEVNRVILHPTYE--MYHPIGGDVALVQLKTRIVFSESV 166

  Fly   130 QAVELPTSPFPRGASELVFTGWGSQSAAGSLPSQLQRVQQQHLNSPACESMMS--AYEDLELGPC 192
            ..|.|.|......::....||||..|..|....:||.:|...:..|.|..:..  :|    :.|.
Human   167 LPVCLATPEVNLTSANCWATGWGLVSKQGETSDELQEMQLPLILEPWCHLLYGHMSY----IMPD 227

  Fly   193 HICAYRQANI-GACHGDSGGPLV----HQGTLVGILNFFVPCAQGV-PDIFMNIMYYRDWM 247
            .:||....|. ..|.||||||||    .....:||:::...|:..: |.::.::.|:..|:
Human   228 MLCAGDILNAKTVCEGDSGGPLVCEFNRSWLQIGIVSWGRGCSNPLYPGVYASVSYFSKWI 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17477NP_650598.1 Tryp_SPc 27..250 CDD:238113 68/239 (28%)
Tryp_SPc 27..246 CDD:214473 67/236 (28%)
PRSS38NP_898885.1 Tryp_SPc 60..291 CDD:238113 68/239 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.