DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17477 and Send1

DIOPT Version :9

Sequence 1:NP_650598.1 Gene:CG17477 / 42067 FlyBaseID:FBgn0038479 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_608662.1 Gene:Send1 / 33407 FlyBaseID:FBgn0031406 Length:255 Species:Drosophila melanogaster


Alignment Length:255 Identity:76/255 - (29%)
Similarity:114/255 - (44%) Gaps:47/255 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LVFSSLYCDLLALEHFIVGGQNAAEGDAPYQVSLQTLLGSHLCGGAIISDRWIITAGHCVKGYPT 75
            |:.|.:...||.....|:||.:....|.|:||||| ..|.|.|||:|.|...||||.||:|   .
  Fly    14 LLISPVVPVLLEPSERIIGGSSMDITDVPWQVSLQ-YYGEHFCGGSIYSKTIIITAAHCIK---E 74

  Fly    76 SRLQVATGTIRYAEPGAVYYPDAIYLHCNYDSPKYQNDIGLLHLNESITFNALTQAVELPTSPFP 140
            ....:..|:..:...|.|...:|..:|..:|....:||:.:|.|:..::|:...|.:.|..:..|
  Fly    75 GERSIRAGSSLHDSGGVVVGVEAYIIHPQFDKHNMENDVAVLKLSSPLSFSDSIQTIPLAETDPP 139

  Fly   141 RGASELVFTGWGSQSAAGSL---PSQLQRVQQQHLNSPACESMMSAYEDLELGPCHICAYRQAN- 201
            ..:|.|. ||||    .|:.   |.|||.|                  ::.:.|..:|..:..| 
  Fly   140 TSSSALA-TGWG----RGNFLIRPRQLQGV------------------EILIRPLIVCKLKYGNG 181

  Fly   202 ------------IGACHGDSGGPLVHQGTLVGILNFF--VPCAQGVPDIFMNIMYYRDWM 247
                        .|.|:||||||||..|.||||.:..  :.|...  .::.::..||:|:
  Fly   182 VFNEDICAGRMGKGGCYGDSGGPLVFNGQLVGITSRTGNIVCLGS--SLYASVARYRNWI 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17477NP_650598.1 Tryp_SPc 27..250 CDD:238113 72/239 (30%)
Tryp_SPc 27..246 CDD:214473 71/236 (30%)
Send1NP_608662.1 Tryp_SPc 29..239 CDD:214473 71/238 (30%)
Tryp_SPc 30..239 CDD:238113 71/237 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.