DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17477 and Ser12

DIOPT Version :9

Sequence 1:NP_650598.1 Gene:CG17477 / 42067 FlyBaseID:FBgn0038479 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_523456.1 Gene:Ser12 / 33406 FlyBaseID:FBgn0011832 Length:245 Species:Drosophila melanogaster


Alignment Length:223 Identity:68/223 - (30%)
Similarity:107/223 - (47%) Gaps:10/223 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 IVGGQNAAEGDAPYQVSLQTLLGSHLCGGAIISDRWIITAGHCVKGYPTSRLQVATGTIRYAEPG 91
            ||||......:.|:|.:|. ....::||..|.||:.||||.|||:....:...|..|::.....|
  Fly    24 IVGGHPVLISEVPWQAALM-YSEKYICGAVIYSDKIIITAAHCVERPFDTLYSVRVGSVWKNLGG 87

  Fly    92 AVYYPDAIYLHCNY-DSPKYQNDIGLLHLNESITFNALTQAVELPTSPFPRGASELVFTGWGSQS 155
            .......|..|.:| .|....|||.::.|.:::.|||..:.::|..|. |...:|...:|||...
  Fly    88 QHARVAVIRKHEDYVSSTILFNDIAVIRLVDTLIFNAEVRPIQLADSA-PAAGTEASVSGWGEIG 151

  Fly   156 AAGSLPSQLQRVQQQHLNSPACESMMSAYEDLELGPCHICAYRQANIGACHGDSGGPLVHQGTLV 220
            .....|:.|.:...:.|:...|:   .:|:  .:....|||..... .:||||||||||..|.||
  Fly   152 ILWLQPTSLLKTSVKILDPNVCK---RSYQ--YITKTMICAAALLK-DSCHGDSGGPLVSGGQLV 210

  Fly   221 GILNFFVPCAQG-VPDIFMNIMYYRDWM 247
            ||:::.:.||.. .|.::.|:...:.|:
  Fly   211 GIVSYGIGCANPFFPGVYANVAELKPWI 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17477NP_650598.1 Tryp_SPc 27..250 CDD:238113 68/223 (30%)
Tryp_SPc 27..246 CDD:214473 67/220 (30%)
Ser12NP_523456.1 Tryp_SPc 23..238 CDD:214473 67/221 (30%)
Tryp_SPc 24..238 CDD:238113 67/221 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.