DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17477 and CG4653

DIOPT Version :9

Sequence 1:NP_650598.1 Gene:CG17477 / 42067 FlyBaseID:FBgn0038479 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_573150.2 Gene:CG4653 / 32650 FlyBaseID:FBgn0030776 Length:254 Species:Drosophila melanogaster


Alignment Length:228 Identity:76/228 - (33%)
Similarity:116/228 - (50%) Gaps:18/228 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 AAEGDAPYQVSLQTLLGSHLCGGAIISDRWIITAGHCV------KGYPTSRLQVATGTIRYAEPG 91
            |..|..|:.:||:. .|.|:||||:|.::||:||.|||      :.||.....|..|:|:....|
  Fly    31 AEVGSQPHSISLRR-NGVHVCGGALIREKWILTAAHCVSLGGGQQSYPAKSYNVRVGSIQRLTGG 94

  Fly    92 AVYYPDAIYLHCNYDSPKY--QNDIGLLHLNESITFNALTQAVELPTSPFPRGASELVFTGWGSQ 154
            .:.....|.:|.||.|...  .||:.||.|..|:..||.|..::|.|.. |...|:::|:||||.
  Fly    95 QLVPLSKIIIHTNYSSSDAVGSNDLALLELETSVVLNANTNPIDLATER-PAAGSQIIFSGWGSS 158

  Fly   155 SAAGSLPSQLQRVQQQHLNSPACESMMSAYED--LELGPCHICAYRQANIGACHGDSGGPLVHQG 217
            ...|||...||...:|.|::..|::.:...::  |.|.|..     :...|.|.||:|.|..:..
  Fly   159 QVDGSLSHVLQVATRQSLSASDCQTELYLQQEDLLCLSPVD-----EDFAGLCSGDAGAPASYNN 218

  Fly   218 TLVGILNFFVP-CAQGVPDIFMNIMYYRDWMRQ 249
            .||||..|||. |....||.::::..:.:|:.:
  Fly   219 QLVGIAAFFVSGCGSEQPDGYVDVTQHLEWINE 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17477NP_650598.1 Tryp_SPc 27..250 CDD:238113 76/228 (33%)
Tryp_SPc 27..246 CDD:214473 75/223 (34%)
CG4653NP_573150.2 Tryp_SPc 30..252 CDD:238113 76/228 (33%)
Tryp_SPc 30..249 CDD:214473 75/224 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 117 1.000 Domainoid score I5856
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.