DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17477 and CG9673

DIOPT Version :9

Sequence 1:NP_650598.1 Gene:CG17477 / 42067 FlyBaseID:FBgn0038479 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001285346.1 Gene:CG9673 / 32649 FlyBaseID:FBgn0030775 Length:261 Species:Drosophila melanogaster


Alignment Length:256 Identity:72/256 - (28%)
Similarity:118/256 - (46%) Gaps:29/256 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 ILVFSSLYCDLLALEHFIVGGQNAAEGDAPYQVSLQTLLGSHLCGGAIISDRWIITAGHCVKG-- 72
            :|:|..:.....:.:..|:||::.|:|:.|:..|:: ...:|:|.|||||...|:||.|||..  
  Fly    12 LLIFGLILSAEASPQGRILGGEDVAQGEYPWSASVR-YNKAHVCSGAIISTNHILTAAHCVSSVG 75

  Fly    73 ---YPTSRLQVATGTIRYAEPGAVYYPDAIYLHCNYDSPKYQNDIGLLHLNESITFNALTQAVEL 134
               ...|.|.|..|||.....|::....::.:|.:|.:  :.:||.:|.|:|::.|:...|.:.|
  Fly    76 ITPVDASTLAVRLGTINQYAGGSIVNVKSVIIHPSYGN--FLHDIAILELDETLVFSDRIQDIAL 138

  Fly   135 P----------TSPFPRGASELVFTGWGSQSAAGSLPSQLQRVQQQHLNSPACE-SMMSAYEDLE 188
            |          .:..|.|....| .|||..| .|:...:.|:.....|:...|| .....||.: 
  Fly   139 PPTTDEETEDVDAELPNGTPVYV-AGWGELS-DGTASYKQQKANYNTLSRSLCEWEAGYGYESV- 200

  Fly   189 LGPCHICAYRQANIGACHGDSGGPLVHQG-TLVGILNF-FVPCAQGVPDIFMNIMYYRDWM 247
                 :|..|....|.|.||:|..::... .|.|:.:| |.||....||:...:.||..|:
  Fly   201 -----VCLSRAEGEGICRGDAGAAVIDDDKVLRGLTSFNFGPCGSKYPDVATRVSYYLTWI 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17477NP_650598.1 Tryp_SPc 27..250 CDD:238113 70/239 (29%)
Tryp_SPc 27..246 CDD:214473 69/236 (29%)
CG9673NP_001285346.1 Tryp_SPc 28..256 CDD:214473 69/238 (29%)
Tryp_SPc 29..259 CDD:238113 70/239 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449454
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.