DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17477 and CG31220

DIOPT Version :9

Sequence 1:NP_650598.1 Gene:CG17477 / 42067 FlyBaseID:FBgn0038479 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_732440.2 Gene:CG31220 / 326126 FlyBaseID:FBgn0051220 Length:363 Species:Drosophila melanogaster


Alignment Length:270 Identity:70/270 - (25%)
Similarity:108/270 - (40%) Gaps:63/270 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 IVGGQNAAEGDAPYQVSL-----------QTLLGSHLCGGAIISDRWIITAGHCVKGYPTSRLQV 80
            ::||......:.|:...|           :.|:.|  |||::|:.|:::||.|||   ..:.||:
  Fly   104 VIGGTEPNLNEYPWLAMLLYRNRSAFNPDRELVPS--CGGSLINTRYVLTAAHCV---TDTVLQI 163

  Fly    81 ATGTIRYAEPGAVYYPD--------------------AIYLHCNYDSPKY--QNDIGLLHLNESI 123
            .  .:|..|....:.||                    :|..|.:||...|  :|||.|:.|.|.:
  Fly   164 Q--RVRLGEHTTSHNPDCISRGARIVCAPTHLDIDVESITSHNDYDPANYTFRNDIALVRLKEPV 226

  Fly   124 TFNALTQA-VELPTSPFPRGAS--ELVFTGWGSQSAAGSLPSQLQRVQQQHLNSPACESMMSAYE 185
            .:   |.| ..:....:||...  ::...||| ::......|::.:.....:..|  |.....|.
  Fly   227 RY---TMAYYPICVLDYPRSLMKFKMYVAGWG-KTGMFDTGSKVLKHAAVKVRKP--EECSEKYA 285

  Fly   186 DLELGP-CHICAYRQANIGACHGDSGGPLVHQGT----------LVGILNFFVPCAQ-GVPDIFM 238
            ....|| ..|||....|.|.|.||||.||:  ||          |.||.::..||.. |.|.:|.
  Fly   286 HRHFGPRFQICAGGLDNRGTCDGDSGSPLM--GTSGRSYETITFLAGITSYGGPCGTIGWPSVFT 348

  Fly   239 NIMYYRDWMR 248
            ....:..|:|
  Fly   349 RTAKFYKWIR 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17477NP_650598.1 Tryp_SPc 27..250 CDD:238113 70/270 (26%)
Tryp_SPc 27..246 CDD:214473 68/266 (26%)
CG31220NP_732440.2 Tryp_SPc 103..357 CDD:214473 68/267 (25%)
Tryp_SPc 104..360 CDD:238113 70/270 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.