DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17477 and CG33159

DIOPT Version :9

Sequence 1:NP_650598.1 Gene:CG17477 / 42067 FlyBaseID:FBgn0038479 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_788455.1 Gene:CG33159 / 318901 FlyBaseID:FBgn0053159 Length:257 Species:Drosophila melanogaster


Alignment Length:231 Identity:66/231 - (28%)
Similarity:108/231 - (46%) Gaps:10/231 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 IVGGQNAAEGDAPYQVSLQTLLGSHLCGGAIISDRWIITAGHCVKGYPTSRLQVATGTIRYAEPG 91
            ||||:.....:.||.|.|:. .|..:|||::||.|.:::|.|||.|.......|..|..|..:..
  Fly    26 IVGGKETTISEVPYLVYLRQ-NGYFICGGSLISSRAVLSAAHCVYGSQPEGFTVHAGASRLDQEA 89

  Fly    92 AVYYPDAIYLHC--NYDSPKYQNDIGLLHLNESITFNALTQAVELPTSPFPRGASELVFTGWGSQ 154
            .| ..:.:..|.  :|.:..:..|:.||.|.|.:.......|...|....|.|.:....:|||..
  Fly    90 PV-VRNVVMFHTSPSYSATNFDMDVALLQLQEVVVLTPGKVATISPCRNPPEGNAYARISGWGVT 153

  Fly   155 SAAGSLPS-QLQRVQQQHLNSPACESMMSAYEDLELGPCHICAYRQANIGACHGDSGGPLVHQGT 218
            ......|: |::....:.|....|:...|.|.  :|....:||..:....:|.||||||||::|.
  Fly   154 RENNREPAEQVRTTMVRVLPGAECKISYSGYG--QLSDSMLCAAVRGLRDSCSGDSGGPLVYRGQ 216

  Fly   219 LVGILNFFVPCAQ-GVPDIFMNIMYYR--DWMRQTM 251
            :.||:::...||: ..|.::.|:...|  :::.||:
  Fly   217 VCGIVSWGFGCARPSFPGVYTNVASERVHEFIEQTL 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17477NP_650598.1 Tryp_SPc 27..250 CDD:238113 64/228 (28%)
Tryp_SPc 27..246 CDD:214473 64/224 (29%)
CG33159NP_788455.1 Tryp_SPc 25..241 CDD:214473 63/218 (29%)
Tryp_SPc 26..251 CDD:238113 64/228 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.