DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17477 and CG31205

DIOPT Version :9

Sequence 1:NP_650598.1 Gene:CG17477 / 42067 FlyBaseID:FBgn0038479 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001287432.1 Gene:CG31205 / 318626 FlyBaseID:FBgn0051205 Length:274 Species:Drosophila melanogaster


Alignment Length:294 Identity:67/294 - (22%)
Similarity:118/294 - (40%) Gaps:73/294 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 RFLFYILVFSSLY-----------CDLLALEHFIVGGQNAAEGDAPYQVSL--QTLLGSH--LCG 54
            :.|.::|..::|:           |.:...:.:......|...:.|:.|.:  .|..||:  ||.
  Fly     5 KLLTFLLTITTLHPTIQAASVGQECGIFNEKQYNSDNIIAEPTEHPWVVRIVGVTKDGSNTLLCT 69

  Fly    55 GAIISDRWIITAGHCV-KGYPTSRLQVATGTIRYAEPGAVYYPDAIYLHCNYDSPKYQNDIGLLH 118
            |.:|..|.::||.||| |....|...|..|.   ::...:....|:.:|.:|...|::||:.::.
  Fly    70 GILIDSRRVVTAAHCVSKDESESIYGVVFGD---SDSSNINLVSAVTVHPDYSPRKFENDLAIIE 131

  Fly   119 LNESITFNALTQAVELPTSPFPRGASELVFTGWGSQSAAGSL-------------PSQLQRVQQQ 170
            |.:.:.|:.|.|.:.||:      .||:|   .||:::...|             .|..||:.::
  Fly   132 LTKEVVFSDLVQPICLPS------VSEMV---PGSETSNSKLIVAGLEGPSFDRRHSATQRLDKR 187

  Fly   171 HLNSPACESMMSAYEDLELGPCH----------ICAYRQANI---GACHGDSGGPLVHQGTLVGI 222
                     :...|..::...||          ||.:.:.:.   .|....||.|  .|..|:||
  Fly   188 ---------IKMTYTKIDSKECHEKQARFPEELICGHTERSPLSGSALTEASGTP--RQFHLLGI 241

  Fly   223 --LNFFVPCA--QGVPDIFMNIMYYRDWMRQTMS 252
              ..||....  ||    ::||..:.||:.:..|
  Fly   242 AVAGFFSSDLDHQG----YLNIRPHLDWISKNSS 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17477NP_650598.1 Tryp_SPc 27..250 CDD:238113 62/257 (24%)
Tryp_SPc 27..246 CDD:214473 60/253 (24%)
CG31205NP_001287432.1 Tryp_SPc 44..>168 CDD:304450 38/135 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.