DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17477 and CG32808

DIOPT Version :9

Sequence 1:NP_650598.1 Gene:CG17477 / 42067 FlyBaseID:FBgn0038479 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_726740.1 Gene:CG32808 / 318221 FlyBaseID:FBgn0052808 Length:284 Species:Drosophila melanogaster


Alignment Length:263 Identity:90/263 - (34%)
Similarity:129/263 - (49%) Gaps:22/263 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LARF-LFYILVFSSLYCDLLALEHFIVGGQNAAEGDAPYQVSL-QTLLGSHLCGGAIISDRWIIT 65
            |||. |||...|  |.......:..||.|..|..|:.|:.||| :...|.|.||..:::..|::|
  Fly     7 LARLALFYTATF--LLAGASGEDGKIVNGTTAGPGEFPFVVSLRRAKSGRHSCGATLLNPYWVLT 69

  Fly    66 AGHCVKGYPTSRLQVATGTIRYAEPGA-VYYPDAIYLHCNYD-SPKYQNDIGLLHLNESITFNAL 128
            |.|||:|....:|.:..|:...|...: |....||::|..|: ..||.|||.||.|.:|:..:..
  Fly    70 AAHCVRGSSPEQLDLQYGSQMLARNSSQVARVAAIFVHPGYEPEDKYVNDIALLQLAQSVALSKF 134

  Fly   129 TQAVELPTSPFPR----GASELVFTGWGSQSAAGSLPSQLQRVQQQHLNSPACESMMSAYEDLEL 189
            .|.|.||.   ||    |.:..|..|||..:..|.:...||:|:.|..:...|......|    |
  Fly   135 VQPVRLPE---PRQVTPGNASAVLAGWGLNATGGVVQQHLQKVKLQVFSDTECSERHQTY----L 192

  Fly   190 GPCHICA-YRQANIGACHGDSGGPLVHQG--TLVGILNFFV-PCAQ-GVPDIFMNIMYYRDWMRQ 249
            ....||| ..:...|.|.|||||||:..|  |.|||:::.: |||: ..|.:|..:..|.||:.:
  Fly   193 HDSQICAGLPEGGKGQCSGDSGGPLLLIGSDTQVGIVSWSIKPCARPPFPGVFTEVSAYVDWIVE 257

  Fly   250 TMS 252
            |::
  Fly   258 TVN 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17477NP_650598.1 Tryp_SPc 27..250 CDD:238113 81/234 (35%)
Tryp_SPc 27..246 CDD:214473 79/230 (34%)
CG32808NP_726740.1 Tryp_SPc 29..255 CDD:214473 80/232 (34%)
Tryp_SPc 30..258 CDD:238113 81/234 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449484
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.