DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17477 and CG32523

DIOPT Version :9

Sequence 1:NP_650598.1 Gene:CG17477 / 42067 FlyBaseID:FBgn0038479 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster


Alignment Length:235 Identity:82/235 - (34%)
Similarity:120/235 - (51%) Gaps:15/235 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 ALEHFIVGGQNAAEGDAPYQVSLQTLLGSHLCGGAIISDRWIITAGHCVKG----YPTSRLQVAT 82
            |:|..||||..|.:|..|:|:||: |.|.|.|||.|||...:||||||||.    .|.....:..
  Fly    32 AIEPRIVGGIKAKQGQFPHQISLR-LRGEHYCGGVIISATHVITAGHCVKHGNDVVPADLWSIQA 95

  Fly    83 GTIRYAEPGAVYYPDA-IYLHCNYDSPKYQNDIGLLHLNESITFNALTQAVELPTSPFPRGASEL 146
            |::..:..| |..|.| :.:|.||.:..: ||:.:|.|...:||:|...|::|.|.. |.....:
  Fly    96 GSLLLSSDG-VRIPVAEVIMHPNYATGGH-NDLAVLRLQSPLTFDANIAAIQLATED-PPNCVAV 157

  Fly   147 VFTGWGSQSAAGSLPSQLQRVQQQHLNSPACESMMSAYEDLELGPCHICAYRQANIGACHGDSGG 211
            ..:|||:.:..|.|...|..||...::..||..|..:    .|....||.....|.|||:|||||
  Fly   158 DISGWGNIAEKGPLSDSLLFVQVTSISRGACRWMFYS----RLPETMICLLHSKNSGACYGDSGG 218

  Fly   212 PLVHQGTLVGILNFFV--PCAQGVPDIFMNIMYYRDWMRQ 249
            |..:.|.:||:.:..:  .|.:..||.::.|...|.|:.:
  Fly   219 PATYGGKVVGLASLLLGGGCGRAAPDGYLRISKVRAWIAE 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17477NP_650598.1 Tryp_SPc 27..250 CDD:238113 80/230 (35%)
Tryp_SPc 27..246 CDD:214473 79/225 (35%)
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 79/227 (35%)
Tryp_SPc 37..219 CDD:238113 69/189 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 117 1.000 Domainoid score I5856
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.