DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17477 and spirit

DIOPT Version :9

Sequence 1:NP_650598.1 Gene:CG17477 / 42067 FlyBaseID:FBgn0038479 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001162707.1 Gene:spirit / 31797 FlyBaseID:FBgn0030051 Length:393 Species:Drosophila melanogaster


Alignment Length:277 Identity:70/277 - (25%)
Similarity:117/277 - (42%) Gaps:66/277 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 IVGGQNAAEGDAPYQVSL-------QTLLGSHLCGGAIISDRWIITAGHC--VKGYPTSRLQVAT 82
            :|||......:.|:..:|       |.:.  :.||||:|::.:::||.||  :.|.|.|::::..
  Fly   132 VVGGMPTRPREFPFMAALGWRSNFDQRIY--YRCGGALIANNFVLTAAHCADLGGEPPSQVRLGG 194

  Fly    83 GTIRYAEPGAVYYPDAIYLHCNYDSPKYQNDIGLLHLNESITFNALTQAVELPTSPFPRGASELV 147
            ..:...| |.......:.:|.:|.:....|||.||               ||.|:..|......:
  Fly   195 DNLTLTE-GEDISIRRVIIHPDYSASTAYNDIALL---------------ELETAAKPELKPTCI 243

  Fly   148 FT------------GWGSQSAAGSLPSQLQRVQQQHLNSPACESMMSAYEDLELGP----CHICA 196
            :|            |:|..|.||...:||.:|..:.:::..|:   ..|:..:|..    ..:||
  Fly   244 WTQKEVTNTLVTAIGYGQTSFAGLSSAQLLKVPLKSVSNEECQ---HHYQKDQLAQGVLGTQMCA 305

  Fly   197 YRQANI----GACHGDSGGPLVHQ----GTLVGILNFFVPCAQGVPDIFMNIMYYRDWMR----- 248
               .:|    ..|.|||||||:.|    |.:|||.:....||.|.|.::..:..:.||:.     
  Fly   306 ---GDITGERDTCQGDSGGPLLMQDGLLGYVVGITSLGQGCASGPPSVYTRVSSFVDWIEGIVWP 367

  Fly   249 -QTMSGNGKCAQVNQQT 264
             |.::   ...|.||.|
  Fly   368 AQQVT---NAPQPNQMT 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17477NP_650598.1 Tryp_SPc 27..250 CDD:238113 65/261 (25%)
Tryp_SPc 27..246 CDD:214473 63/251 (25%)
spiritNP_001162707.1 CLIP 51..98 CDD:197829
Tryp_SPc 132..364 CDD:238113 65/255 (25%)
Tryp_SPc 132..361 CDD:214473 64/252 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.