DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17477 and Klk15

DIOPT Version :9

Sequence 1:NP_650598.1 Gene:CG17477 / 42067 FlyBaseID:FBgn0038479 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_777354.1 Gene:Klk15 / 317652 MGIID:2447533 Length:254 Species:Mus musculus


Alignment Length:232 Identity:66/232 - (28%)
Similarity:107/232 - (46%) Gaps:15/232 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 IVGGQNAAEGDAPYQVSLQTLLGSHLCGGAIISDRWIITAGHCVKGYPTSRLQVATGTIR-YAEP 90
            ::.|:.......|:||:|.. .|...||..:||.||::||.||...:  .|:::....:| :..|
Mouse    20 VLEGEECVPHSQPWQVALFE-RGRFNCGAFLISPRWVLTAAHCQTRF--MRVRLGEHNLRKFDGP 81

  Fly    91 GAVYYPDAIYLHCNYDSPKYQNDIGLLHLNESITFNALTQAVELPTSPFPRGASELVFTGWG--- 152
            ..:.....|..|..|::..:::||.||.|.:.....|..:.|.||.. .|....:.|.:|||   
Mouse    82 EQLRSVSRIIPHPGYEARTHRHDIMLLRLFKPARLTAYVRPVALPRR-CPLIGEDCVVSGWGLLS 145

  Fly   153 --SQSAAGSLPSQLQRVQQQHLNSPACESMMSAYEDL--ELGPCHICA-YRQANIGACHGDSGGP 212
              :..|.||..|.::.....|..:.:..|..|..:|.  .:.|..:|| .......:|.||||||
Mouse   146 DNNPGATGSQKSHVRLPDTLHCANISIISEASCNKDYPGRVLPTMVCAGVEGGGTDSCEGDSGGP 210

  Fly   213 LVHQGTLVGILNF-FVPC-AQGVPDIFMNIMYYRDWM 247
            ||..|.|.||::: .||| ....|.::..:..|.:|:
Mouse   211 LVCGGALQGIVSWGDVPCDTTTKPGVYTKVCSYLEWI 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17477NP_650598.1 Tryp_SPc 27..250 CDD:238113 66/232 (28%)
Tryp_SPc 27..246 CDD:214473 65/229 (28%)
Klk15NP_777354.1 Tryp_SPc 23..247 CDD:238113 65/227 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.