DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17477 and Prtn3

DIOPT Version :9

Sequence 1:NP_650598.1 Gene:CG17477 / 42067 FlyBaseID:FBgn0038479 Length:267 Species:Drosophila melanogaster
Sequence 2:XP_038934901.1 Gene:Prtn3 / 314615 RGDID:1304898 Length:422 Species:Rattus norvegicus


Alignment Length:233 Identity:68/233 - (29%)
Similarity:97/233 - (41%) Gaps:21/233 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 IVGGQNAAEGDAPYQVSLQTLL--GSHLCGGAIISDRWIITAGHCVKGYPTSRLQVATGT--IRY 87
            ||||..|.....||..|||...  |||.|||.:|..|:::||.||::......:.|..|.  :..
  Rat   198 IVGGHEARPHSRPYVASLQLSRSPGSHFCGGTLIHPRFVLTAAHCLQDISWQLVTVVLGAHDLLS 262

  Fly    88 AEPGAVYYPDAIYLHCNYDSPKYQNDIGLLHLNESITFNALTQAVELP--TSPFPRGASELVFTG 150
            :||....:........||:..:..||:.||.||...:.........||  .....:| ::.:..|
  Rat   263 SEPEQQKFTITQVFENNYNPEETLNDVLLLQLNRPASLGKQVAVASLPQQDQSLSQG-TQCLAMG 326

  Fly   151 WGSQSAAGSLPSQLQRVQQQHLNSPACESMMSAYEDLELGPCHICAYRQANIGACHGDSGGPLVH 215
            ||........|..|     ..||......:...:....|.|      |:| .|.|.|||||||:.
  Rat   327 WGRLGTRAPTPRVL-----HELNVTVVTFLCREHNVCTLVP------RRA-AGICFGDSGGPLIC 379

  Fly   216 QGTLVGILNFFV-PCAQ-GVPDIFMNIMYYRDWMRQTM 251
            .|.|.|:.:|.: .||. ..||.|..:..|.:|:...:
  Rat   380 NGILHGVDSFVIRECASLQFPDFFARVSMYVNWIHSVL 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17477NP_650598.1 Tryp_SPc 27..250 CDD:238113 68/230 (30%)
Tryp_SPc 27..246 CDD:214473 67/226 (30%)
Prtn3XP_038934901.1 Tryp_SPc 198..416 CDD:238113 68/230 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.