DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17477 and Klk8

DIOPT Version :9

Sequence 1:NP_650598.1 Gene:CG17477 / 42067 FlyBaseID:FBgn0038479 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001100979.1 Gene:Klk8 / 308565 RGDID:1305998 Length:260 Species:Rattus norvegicus


Alignment Length:246 Identity:68/246 - (27%)
Similarity:109/246 - (44%) Gaps:43/246 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 IVGGQNAAEGDAPYQVSLQTLLGSHL-CGGAIISDRWIITAGHCVK---------------GYPT 75
            |:.||.......|:|.:|  ..|..| |||.::.|||::||.||.|               ..|.
  Rat    33 ILEGQECKPHSQPWQTAL--FQGERLVCGGVLVGDRWVLTAAHCKKDKYSVRLGDHSLQKRDEPE 95

  Fly    76 SRLQVATGTIRYAEPGAVYYPDAIYLHC-NYDSPK-YQNDIGLLHLNESITFNALTQAVELPTSP 138
            ..:|||.         ::.:|      | |..:|: :.:||.|:.|..|.......:.:|| .:.
  Rat    96 QEIQVAR---------SIQHP------CFNSSNPEDHSHDIMLIRLQNSANLGDKVKPIEL-ANL 144

  Fly   139 FPRGASELVFTGWGS-QSAAGSLPSQLQRVQQQHLNSPACESMMSAYEDLELGPCHICAYRQANI 202
            .|:...:.:.:|||: .|...:.|:.|...:.:..:...||   .||.. ::....:||......
  Rat   145 CPKVGQKCIISGWGTVTSPQENFPNTLNCAEVKIYSQNKCE---RAYPG-KITEGMVCAGSSNGA 205

  Fly   203 GACHGDSGGPLVHQGTLVGILNF-FVPCAQ-GVPDIFMNIMYYRDWMRQTM 251
            ..|.||||||||..|.|.||.:: ..||.: ..|.::..|..|.:|:::||
  Rat   206 DTCQGDSGGPLVCNGVLQGITSWGSDPCGKPEKPGVYTKICRYTNWIKKTM 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17477NP_650598.1 Tryp_SPc 27..250 CDD:238113 66/243 (27%)
Tryp_SPc 27..246 CDD:214473 65/239 (27%)
Klk8NP_001100979.1 Tryp_SPc 32..252 CDD:214473 65/240 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166341239
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.