DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17477 and Klk14

DIOPT Version :9

Sequence 1:NP_650598.1 Gene:CG17477 / 42067 FlyBaseID:FBgn0038479 Length:267 Species:Drosophila melanogaster
Sequence 2:XP_038956840.1 Gene:Klk14 / 308562 RGDID:1308606 Length:310 Species:Rattus norvegicus


Alignment Length:272 Identity:78/272 - (28%)
Similarity:120/272 - (44%) Gaps:41/272 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 ARFLFYILVFSSLYCDLLAL--EHFIVGGQNAAEGDAPYQVSLQTLLGSH-LCGGAIISDRWIIT 65
            :|.|..:.:..:|...::..  :..|:||....:...|:||:||...|.. ||||.::||:|:||
  Rat    59 SRMLLLLTILQALAVAIVQSQGDDKILGGYTCVQNSQPWQVALQAGPGRRFLCGGVLLSDQWVIT 123

  Fly    66 AGHCVKGYPTSRLQVATG--TIRYAE------------PGAVYYPDAIYLHCNYDSPKYQNDIGL 116
            |.||.:    ..|.||.|  .:|..|            |...|.|.|           :.||:.|
  Rat   124 AAHCAR----PLLHVALGKHNLRRWEATQQVLRVVRQVPHPQYRPQA-----------HDNDLML 173

  Fly   117 LHLNESITFNALTQAVELPTSPFPRGASELVFTGWG-SQSAAGSLPSQLQRVQQQHLNSPACESM 180
            |.|...:......:.:.:..|....|....| :||| :.|.....|:.||.|....:....|.  
  Rat   174 LKLQRKVRLGRAVRTIPVARSCASPGTPCRV-SGWGTTASPIVRYPTALQCVNVNIMPEQVCH-- 235

  Fly   181 MSAYEDLELGPCHICA-YRQANIGACHGDSGGPLVHQGTLVGILNFFVP-CAQ-GVPDIFMNIMY 242
             .||.. .:....:|| ..:....:|.||||||||.||.|.|::::.:. ||. |.|.::.|:..
  Rat   236 -RAYPG-TITSGMVCAGVPEGGKDSCQGDSGGPLVCQGQLQGLVSWGMERCAMPGYPGVYTNLCN 298

  Fly   243 YRDWMRQTMSGN 254
            |..|:::||..|
  Rat   299 YHSWIQRTMQSN 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17477NP_650598.1 Tryp_SPc 27..250 CDD:238113 72/241 (30%)
Tryp_SPc 27..246 CDD:214473 71/237 (30%)
Klk14XP_038956840.1 Tryp_SPc 84..306 CDD:238113 72/241 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166341222
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.