DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17477 and Elane

DIOPT Version :9

Sequence 1:NP_650598.1 Gene:CG17477 / 42067 FlyBaseID:FBgn0038479 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001100237.1 Gene:Elane / 299606 RGDID:1307968 Length:271 Species:Rattus norvegicus


Alignment Length:251 Identity:84/251 - (33%)
Similarity:113/251 - (45%) Gaps:23/251 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SLARFLFYILVFSSLYCDLLALEHFIVGGQNAAEGDAPYQVSLQTLLGSHLCGGAIISDRWIITA 66
            :||..|..:|    |.|..||.|  ||||:.|.....|:.||||. .|.|.||..:|:..::::|
  Rat    14 TLASMLLALL----LVCPALASE--IVGGRPAQPHAWPFMVSLQR-RGGHFCGATLIARNFVMSA 71

  Fly    67 GHCVKGYPTSRLQVATGT--IRYAEPGAVYYPDAIYLHCNYDSPKYQNDIGLLHLNESITFNALT 129
            .|||.|.....:||..|.  :|..||....:.........:|..:..|||.::.||.|.|.||..
  Rat    72 AHCVNGRNFQSVQVVLGAHDLRRREPTRQIFSVQRIFENGFDPSRLLNDIVIIQLNGSATINANV 136

  Fly   130 QAVELPTSPFPRG-ASELVFTGWGSQSAAGSLPSQLQRVQQQHLNSPACESMMSAYEDLELGPCH 193
            |..|||......| .:..|..|||.......|||.||.:....:.: .|...::.        |.
  Rat   137 QVAELPAQGQGVGNRTPCVAMGWGRLGTNRPLPSVLQELNVTVVTN-LCRRRVNV--------CT 192

  Fly   194 ICAYRQANIGACHGDSGGPLVHQGTLVGILNFF-VPCAQG-VPDIFMNIMYYRDWM 247
            :...|||  |.|.||||||||....:.||.:|. ..|..| .||.|..:..:.||:
  Rat   193 LVPRRQA--GICFGDSGGPLVCNNLVQGIDSFIRGGCGSGFYPDAFAPVAEFADWI 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17477NP_650598.1 Tryp_SPc 27..250 CDD:238113 75/226 (33%)
Tryp_SPc 27..246 CDD:214473 73/223 (33%)
ElaneNP_001100237.1 Tryp_SPc 32..246 CDD:214473 75/227 (33%)
Tryp_SPc 33..249 CDD:238113 75/226 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.