DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17477 and Klk1c3

DIOPT Version :9

Sequence 1:NP_650598.1 Gene:CG17477 / 42067 FlyBaseID:FBgn0038479 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001258244.1 Gene:Klk1c3 / 292872 RGDID:735032 Length:255 Species:Rattus norvegicus


Alignment Length:242 Identity:71/242 - (29%)
Similarity:113/242 - (46%) Gaps:26/242 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 IVGGQNAAEGDAPYQVSLQTLLGSHLCGGAIISDRWIITAGHCVKGYPTSRLQVATGTIRYAEPG 91
            :|||....:...|:||:   ::...||||.:|...|:|||.||.    :....|..|....:|..
  Rat    25 VVGGFKCEKNSQPWQVA---VINEDLCGGVLIDPSWVITAAHCY----SDNYHVLLGQNNLSEDV 82

  Fly    92 AVYYPDAIYLHCNYD---------SPK-YQNDIGLLHLNESITFNALTQAVELPTSPFPRGASEL 146
            ........:.|.:|.         .|| |.||:.||||:|........:.::|||.. |:..|..
  Rat    83 QHRLVSQSFRHPDYKPFLMRNHTRKPKDYSNDLMLLHLSEPADITDGVKVIDLPTKE-PKVGSTC 146

  Fly   147 VFTGWGSQS-AAGSLPSQLQRVQQQHLNSPACESMMSAYEDLELGPCHICAYR-QANIGACHGDS 209
            :.:||||.: :....|..||.|....|::..|   :.||:: ::....:||.. :.....|.|||
  Rat   147 LVSGWGSTNPSEWEFPDDLQCVNIHLLSNEKC---IKAYKE-KVTDLMLCAGELEGGKDTCRGDS 207

  Fly   210 GGPLVHQGTLVGILNF-FVPCAQ-GVPDIFMNIMYYRDWMRQTMSGN 254
            ||||:..|.|.||.:: .|||.: ..|.|:..::.:..|:::.|..|
  Rat   208 GGPLICDGVLQGITSWGSVPCGEPNKPGIYTKLIKFTSWIKEVMKKN 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17477NP_650598.1 Tryp_SPc 27..250 CDD:238113 69/236 (29%)
Tryp_SPc 27..246 CDD:214473 68/232 (29%)
Klk1c3NP_001258244.1 Tryp_SPc 24..247 CDD:214473 68/233 (29%)
Tryp_SPc 25..250 CDD:238113 69/236 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166341226
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.