DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17477 and Klk1c9

DIOPT Version :9

Sequence 1:NP_650598.1 Gene:CG17477 / 42067 FlyBaseID:FBgn0038479 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_786935.1 Gene:Klk1c9 / 292868 RGDID:727805 Length:259 Species:Rattus norvegicus


Alignment Length:245 Identity:65/245 - (26%)
Similarity:113/245 - (46%) Gaps:28/245 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 IVGGQNAAEGDAPYQVSLQTLLGSHLCGGAIISDRWIITAGHC--------------VKGYPTSR 77
            :|||.|......|:||:   ::|:..|||.:|...|:|||.||              ||..|.::
  Rat    25 VVGGYNCETNSQPWQVA---VIGTTFCGGVLIDPSWVITAAHCYSKNYRVLLGRNNLVKDEPFAQ 86

  Fly    78 LQVATGTIRYAEPGAVYYPDAIYLHCNYDSPKYQNDIGLLHLNESITFNALTQAVELPTSPFPRG 142
            .::.:.:.::.:    |.|..:..|....:..:.||:.||||::........:.::|||.. |:.
  Rat    87 RRLVSQSFQHPD----YIPVFMRNHTRQRAYDHNNDLMLLHLSKPADITGGVKVIDLPTEE-PKV 146

  Fly   143 ASELVFTGWG-SQSAAGSLPSQLQRVQQQHLNSPACESMMSAYEDLELGPCHICAYRQANIGACH 206
            .|..:.:||| :..:...|...||.|....|::..|   :..|:::|................|.
  Rat   147 GSICLASGWGMTNPSEMKLSHDLQCVNIHLLSNEKC---IETYKNIETDVTLCAGEMDGGKDTCT 208

  Fly   207 GDSGGPLVHQGTLVGILN-FFVPCAQ-GVPDIFMNIMYYRDWMRQTMSGN 254
            |||||||:..|.|.|:.: ...|||: ..|.|:..::.:..|:::.|..|
  Rat   209 GDSGGPLICDGVLQGLTSGGATPCAKPKTPAIYAKLIKFTSWIKKVMKEN 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17477NP_650598.1 Tryp_SPc 27..250 CDD:238113 63/239 (26%)
Tryp_SPc 27..246 CDD:214473 62/235 (26%)
Klk1c9NP_786935.1 Tryp_SPc 24..251 CDD:214473 62/236 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166341228
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.