DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17477 and Klk7

DIOPT Version :9

Sequence 1:NP_650598.1 Gene:CG17477 / 42067 FlyBaseID:FBgn0038479 Length:267 Species:Drosophila melanogaster
Sequence 2:XP_017444408.1 Gene:Klk7 / 292852 RGDID:1306420 Length:249 Species:Rattus norvegicus


Alignment Length:251 Identity:76/251 - (30%)
Similarity:122/251 - (48%) Gaps:17/251 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LFYILVFSSLYCDLLALEHFIVGGQNAAEGDAPYQVSLQTLLGSHL-CGGAIISDRWIITAGHCV 70
            |..:.|..||..:.......|:.|....||..|:||:|  |.|..| |||.::.:.|::||.||.
  Rat     6 LSLLTVLLSLALETAGQGERIIDGYKCKEGSHPWQVAL--LKGDQLHCGGVLVGESWVLTAAHCK 68

  Fly    71 KGYPTSRLQVATGTIRYAEPGAV-YYPDAIYLHCNYDSPKYQNDIGLLHLNESITFNALTQAVEL 134
            .|..|..|    |:.:..:..|. ......:.|..|.:..:.|||.|:.:::.:..:...|.|:|
  Rat    69 MGQYTVHL----GSDKIEDQSAQRIKASRSFRHPGYSTRTHVNDIMLVKMDKPVKMSDKVQKVKL 129

  Fly   135 PTSPFPRGASELVFTGWGSQSAAG-SLPSQLQRVQQQHLNSPACESMMSAYEDLELGPCHICA-Y 197
            |....|.|....| :|||:.::.. :.||.|.....:.::|..|:.:   |:|| ||...:|| .
  Rat   130 PDHCEPPGTLCTV-SGWGTTTSPDVTFPSDLMCSDVKLISSQECKKV---YKDL-LGKTMLCAGI 189

  Fly   198 RQANIGACHGDSGGPLVHQGTLVGILNF-FVPCAQ-GVPDIFMNIMYYRDWMRQTM 251
            ..:....|:||||||||...||.|:::: ..||.| ..|.::..:..|:.|:..||
  Rat   190 PDSKTNTCNGDSGGPLVCNDTLQGLVSWGTYPCGQPNDPGVYTQVCKYQRWLEDTM 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17477NP_650598.1 Tryp_SPc 27..250 CDD:238113 70/228 (31%)
Tryp_SPc 27..246 CDD:214473 69/224 (31%)
Klk7XP_017444408.1 Tryp_SPc 25..240 CDD:214473 69/225 (31%)
Tryp_SPc 26..244 CDD:238113 70/228 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166341224
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.