DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17477 and Klk11

DIOPT Version :9

Sequence 1:NP_650598.1 Gene:CG17477 / 42067 FlyBaseID:FBgn0038479 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001099722.1 Gene:Klk11 / 292849 RGDID:1308690 Length:279 Species:Rattus norvegicus


Alignment Length:272 Identity:73/272 - (26%)
Similarity:117/272 - (43%) Gaps:40/272 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSLARFLFYILVFSSLYCDLLALEHFIVGGQNAAEGDAPYQVSL--QTLLGSHLCGGAIISDRWI 63
            |.:.||:...||...     :..|..|:.|........|:||:|  :|.|   |||..:|:.:|:
  Rat    30 MMILRFIALALVTGH-----VGGETRIIKGYECRPHSQPWQVALFQKTRL---LCGATLIAPKWL 86

  Fly    64 ITAGHCVKGYPTSRL------------QVATGTIRYAEPGAVYYPDAIYLHCNYDSPKYQNDIGL 116
            :||.||.|.:....|            |....|..:..||         .:.:..:..::|||.|
  Rat    87 LTAAHCRKPHYVILLGEHNLEKTDGCEQRRMATESFPHPG---------FNNSLPNKDHRNDIML 142

  Fly   117 LHLNESITFNALTQAVELPTSPFPRGASELVFTGWGSQSAAG-SLPSQLQRVQQQHLNSPACESM 180
            :.::.........:.:.|.:.....|.|.|: :|||:.|:.. .||..|:......:....||  
  Rat   143 VKMSSPAFITRAVRPLTLSSLCVTAGTSCLI-SGWGTTSSPQLRLPHSLRCANVSIIGHKECE-- 204

  Fly   181 MSAYEDLELGPCHICA-YRQANIGACHGDSGGPLVHQGTLVGILNFFV-PCA-QGVPDIFMNIMY 242
             .||.. .:....:|| .|:....:|.||||||||..|:|.||:::.. ||| ...|.::..:..
  Rat   205 -RAYPG-NITDTMLCASVRKEGKDSCQGDSGGPLVCNGSLQGIISWGQDPCAVTRKPGVYTKVCK 267

  Fly   243 YRDWMRQTMSGN 254
            |.||:.:.|..|
  Rat   268 YFDWIHEVMRNN 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17477NP_650598.1 Tryp_SPc 27..250 CDD:238113 65/240 (27%)
Tryp_SPc 27..246 CDD:214473 63/236 (27%)
Klk11NP_001099722.1 Tryp_SPc 50..272 CDD:214473 64/238 (27%)
Tryp_SPc 51..275 CDD:238113 65/240 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166341238
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.