DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17477 and Prss34

DIOPT Version :9

Sequence 1:NP_650598.1 Gene:CG17477 / 42067 FlyBaseID:FBgn0038479 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001099242.1 Gene:Prss34 / 287140 RGDID:1306667 Length:316 Species:Rattus norvegicus


Alignment Length:257 Identity:70/257 - (27%)
Similarity:108/257 - (42%) Gaps:50/257 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 IVGGQNAAEGDAPYQVSL-----QTLLGSHLCGGAIISDRWIITAGHCV--KGYPTSRLQVATGT 84
            ||||...:....|:||||     :.....|:|||::|..:|::||.|||  |....|..:|..|.
  Rat    33 IVGGCPVSASRFPWQVSLRFYNMKLSKWEHICGGSLIHPQWVLTAAHCVELKEMEASCFRVQVGQ 97

  Fly    85 IRYAEPGAVYYPDAIYLHCNYDSPKYQN--------DIGLLHLNESITFNALTQAVELPTSPFPR 141
            :|..|...:.....|..|     ||:..        ||.||.|:.::..:.....|.||      
  Rat    98 LRLYENDQLMKVAKIIRH-----PKFSEKLSAPGGADIALLKLDSTVVLSERVHPVSLP------ 151

  Fly   142 GASELV-------FTGWGSQSAAGSL--PSQLQRVQQQHLNSPACESMMSAYEDLE-----LGPC 192
            .||:.:       ..|||.......|  |..|:.|....:.:..||.....|..|:     :...
  Rat   152 AASQRISSKKTWWVAGWGVIEGHRPLPPPCHLREVAVPIVGNSDCEQKYRTYSSLDRTTKIIKDD 216

  Fly   193 HICAYRQANIGACHGDSGGPLVHQGTL----VGILNFFVPCAQGVPD---IFMNIMYYRDWM 247
            .:||..:.. .:|..|||||||.:...    ||::::.:.|  |:||   ::..:|.|..|:
  Rat   217 MLCAGMEGR-DSCQADSGGPLVCRWNCSWVQVGVVSWGIGC--GLPDFPGVYTRVMSYLSWI 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17477NP_650598.1 Tryp_SPc 27..250 CDD:238113 70/257 (27%)
Tryp_SPc 27..246 CDD:214473 69/254 (27%)
Prss34NP_001099242.1 Tryp_SPc 33..276 CDD:238113 70/257 (27%)
Tryp_SPc 33..275 CDD:214473 69/255 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.